BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0412 (417 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 8e-08 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 53 1e-07 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 1e-07 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 37 0.008 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 36 0.013 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.013 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 35 0.023 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.054 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 34 0.054 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.054 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 33 0.12 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.12 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.38 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.67 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 30 0.88 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 30 0.88 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.88 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 29 1.2 SB_22052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 29 1.5 SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) 29 1.5 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 29 2.0 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 29 2.0 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_49820| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_34470| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 53.2 bits (122), Expect = 8e-08 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGF 253 +RVY+G + + K ++EREF+ +G L VWVA NPPGF Sbjct: 2 SRVYIGNIGDNASKREIEREFETFGPLRDVWVARNPPGF 40 Score = 31.1 bits (67), Expect = 0.38 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 244 PRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 354 P F F FE+ ++AEDA ++G + G +VE+++ Sbjct: 38 PGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELAK 74 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 52.8 bits (121), Expect = 1e-07 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGF 253 T++YVG L +LER F+K+G+L+ VWVA NPPGF Sbjct: 4 TKLYVGNLGRNADSSELERAFEKFGRLSKVWVARNPPGF 42 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 52.4 bits (120), Expect = 1e-07 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGF 253 T+VY+G L + K ++E EF YG L VWVA NPPGF Sbjct: 32 TKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNPPGF 70 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 37.5 bits (83), Expect = 0.004 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +1 Query: 238 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV--EISRKRD 363 +S F F+ F N ++A+ A ++NG E+ G TLK+ ISR RD Sbjct: 97 RSRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKIAPSISRGRD 140 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 36.7 bits (81), Expect = 0.008 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 354 + F+EFE+ ++A+DA NG EMLG + VE SR Sbjct: 38 YGFVEFEDDRDADDAVYECNGKEMLGERILVEHSR 72 Score = 30.3 bits (65), Expect = 0.67 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +2 Query: 140 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFV 256 RVY+G L G ++D+ R F YG+L + + N GFV Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLK-NNYGFV 41 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.9 bits (79), Expect = 0.013 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRKR 360 + F+EF++ ++AEDA +NG +++G + VE S+ R Sbjct: 724 YGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFSKGR 760 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.9 bits (79), Expect = 0.013 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 244 PRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 354 P F F+EFE+ ++AEDA +G E G ++VE R Sbjct: 300 PPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVEFPR 336 Score = 31.5 bits (68), Expect = 0.29 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 125 SSGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSV 226 +S RVYVG L + ++++DL F KYG + V Sbjct: 257 NSNDCRVYVGNLPQDVREKDLHDIFYKYGHIADV 290 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 35.5 bits (78), Expect = 0.018 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVE 345 + +E+E +EA+ A A+NG EMLG + V+ Sbjct: 336 YALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 35.1 bits (77), Expect = 0.023 Identities = 17/41 (41%), Positives = 25/41 (60%) Frame = +1 Query: 238 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRKR 360 KS F F+ FE +EAE+A + +NG E+ G L ++KR Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRLWAGRAKKR 187 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 33.9 bits (74), Expect = 0.054 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRKRD 363 F F+ ++N+ A++A MNG ++ LKV++ R +D Sbjct: 305 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKD 342 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 33.9 bits (74), Expect = 0.054 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRKRD 363 F F+ ++N+ A++A MNG ++ LKV++ R +D Sbjct: 320 FGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKD 357 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 33.9 bits (74), Expect = 0.054 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 226 TR++VGGL I +LEREFD++G + + Sbjct: 318 TRLWVGGLGPWISIPELEREFDRFGAIRRI 347 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 32.7 bits (71), Expect = 0.12 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = +2 Query: 143 VYVGGLVEGIKKEDLEREFDKYGKLNSV 226 ++VG L E I++ED+ + F +YG++ SV Sbjct: 8 LWVGNLPENIREEDIVKHFTRYGRVESV 35 Score = 30.3 bits (65), Expect = 0.67 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +2 Query: 143 VYVGGLVEGIKKEDLEREFDKYGKLNSV 226 ++VGG+ + ++ +ER F +YG++ V Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKV 357 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 32.7 bits (71), Expect = 0.12 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +2 Query: 122 MSSGGTRVYVGGLVEGIKKEDLEREFDKYGKL 217 M+S GT+++VG L + K DLE F YGKL Sbjct: 1 MASRGTQLFVGRLSKETKLRDLENVFYLYGKL 32 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.1 bits (67), Expect = 0.38 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 238 KSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV 342 K + FIE+EN Q A DA ++MN ++ G L+V Sbjct: 238 KHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRV 272 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 30.3 bits (65), Expect = 0.67 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 354 + F+ ++N +A A MNG + TLKV +R Sbjct: 70 YAFVNYDNPDDANKAVREMNGARLQNKTLKVSFAR 104 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 29.9 bits (64), Expect = 0.88 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 143 VYVGGLVEGIKKEDLEREFDKYGKLNSV 226 V+VG L +KK+ L++ F KYG++ SV Sbjct: 23 VFVGNLPLTLKKKALKKYFSKYGEVESV 50 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 29.9 bits (64), Expect = 0.88 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 232 STKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKV 342 + +S + F++F + A+ A MNG E+ G LK+ Sbjct: 279 TNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 0.88 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKLNSV 226 T +YVGGL + ++DL F ++G+L S+ Sbjct: 304 TTLYVGGLEGKVTEQDLRDHFYQFGELRSI 333 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 29.9 bits (64), Expect = 0.88 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 125 SSGGTRVYVGGLVEGIKKEDLEREFDKYG 211 S+ +V++GGL G +EDL+ F YG Sbjct: 198 SANDGKVFIGGLAFGTTEEDLKEYFSTYG 226 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 143 VYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPG 250 VYVG + + K+D+ R F KYG + V V G Sbjct: 372 VYVGKISDETHKDDVWRRFRKYGPIEKVTVHFRDNG 407 >SB_22052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 253 RFIEFENLQEAEDACSAMNGTEM-LGATLKVEISRKR 360 RF+ F + +EAE A +G ++ G L+V++S+KR Sbjct: 146 RFVGFSSYREAEHAIRKFDGFDLGQGLRLRVQLSKKR 182 >SB_4587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2656 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/37 (37%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 253 RFIEFENLQEAEDACSAMNGTEM-LGATLKVEISRKR 360 RF+ F + +EAE A +G ++ G L+V++S+KR Sbjct: 46 RFVGFSSYREAEHAIRKFDGFDLGQGLRLRVQLSKKR 82 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 143 VYVGGLVEGIKKEDLEREFDKYGKLNSVWV 232 VYVG L + DL + F++YGK+ V + Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTI 41 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 29.1 bits (62), Expect = 1.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 140 RVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALN 241 +++VGGL KE L+ F KYG+L V + ++ Sbjct: 30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMD 63 >SB_11106| Best HMM Match : RRM_1 (HMM E-Value=1.8e-11) Length = 67 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLG 327 + F+EF+ +AEDA NG +MLG Sbjct: 40 YGFVEFDYSDDAEDAVYECNGKKMLG 65 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 28.7 bits (61), Expect = 2.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 140 RVYVGGLVEGIKKEDLEREFDKYGKL 217 +V++G L G+K D+ F KYG + Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGTI 383 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 28.7 bits (61), Expect = 2.0 Identities = 8/27 (29%), Positives = 20/27 (74%) Frame = +2 Query: 140 RVYVGGLVEGIKKEDLEREFDKYGKLN 220 ++++GGL +ED+++ F ++GK++ Sbjct: 184 KIFIGGLSTNTSEEDMKKYFSQFGKVS 210 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 2.7 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -3 Query: 412 PEVTAAPTS*TH--LCG-GRPAF*RSLLSKWRLTSQYHSSRYTHLPPPASS 269 P++T AP H LC G P + T++YH ++T LPPP+ S Sbjct: 136 PKLTKAPKGAWHCVLCSTGIPPQSPLTSTICEETTEYHPEQHTPLPPPSKS 186 >SB_28089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 28.3 bits (60), Expect = 2.7 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 128 SGGTRVYVGGLVEGIKKEDLEREFDKYGKLNSVWVALNPPGFV 256 S TRVY G L ++ DLE+ YG++ + + L GFV Sbjct: 2 SRSTRVYFGRLPRDCRERDLEKFVRGYGRVREISMKLG-YGFV 43 Score = 27.5 bits (58), Expect = 4.7 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLG 327 + F+EF++ ++A+D +NG +LG Sbjct: 40 YGFVEFDDYRDADDCVYDLNGRNLLG 65 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 27.9 bits (59), Expect = 3.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 137 TRVYVGGLVEGIKKEDLEREFDKYGKL 217 T VYVG L +K +L++ F +YG + Sbjct: 615 TTVYVGNLPPDVKDYELQQMFSQYGSI 641 >SB_37668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 26.6 bits (56), Expect = 8.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +1 Query: 205 IWKTKLSLGSTKSPRFRFIEFENLQEAEDACSAMNGTEMLGATLKVEISRKR 360 IW K GS+K + +E+ A A NG + +G ++KVE++ R Sbjct: 207 IWIYKHPDGSSKGECT--VTYEDPPTASAAIEWFNGKDFMGQSIKVELAEAR 256 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 250 FRFIEFENLQEAEDACSAMNGTEMLGATLKVEISR 354 F F+++ ++A+ A +NG + LKV SR Sbjct: 90 FGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSR 124 >SB_49820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.6 bits (56), Expect = 8.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 198 NSRSRSSFLIPSTRPPTYTRVPPELMV 118 N SRS+FL+P+ PT+ +V +L V Sbjct: 110 NPGSRSAFLLPTMAYPTFIQVMRDLKV 136 >SB_34470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 241 SPRFRFIEFENLQEAEDACSAMNGTEMLG 327 SP +EF++ ++A+DA +N E+LG Sbjct: 304 SPSKENLEFDDARDADDAVYELNHKELLG 332 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,966,187 Number of Sequences: 59808 Number of extensions: 196194 Number of successful extensions: 555 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -