BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0409 (483 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 24 2.4 AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 24 2.4 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 24 2.4 AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 22 9.6 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 24.2 bits (50), Expect = 2.4 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +2 Query: 308 LKYLVNSHVSSNLLNYRDSTTFSIEIISPKYSCKKGLFXEM 430 + Y N+H+ + + + ++ P+ KKGLF M Sbjct: 57 ISYQPNAHLGEQITYSKTQGSVECTLVIPQAKNKKGLFLTM 97 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 24.2 bits (50), Expect = 2.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 336 ET*ELTKYFNFETINEKQKFIFTVHILIITENNYTKIFRPTSIYW 202 +T EL K F+F +++ I H L +TE F+ + W Sbjct: 255 QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 299 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 24.2 bits (50), Expect = 2.4 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -1 Query: 336 ET*ELTKYFNFETINEKQKFIFTVHILIITENNYTKIFRPTSIYW 202 +T EL K F+F +++ I H L +TE F+ + W Sbjct: 291 QTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 335 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 22.2 bits (45), Expect = 9.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 115 TQRCTTSKKRCC 150 T CT KRCC Sbjct: 23 TTACTAGNKRCC 34 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 375,227 Number of Sequences: 2352 Number of extensions: 5746 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -