Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0409
         (483 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g07680.1 68415.m00992 ABC transporter family protein                30   0.94 

>At2g07680.1 68415.m00992 ABC transporter family protein 
          Length = 1194

 Score = 29.9 bits (64), Expect = 0.94
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = -3

Query: 130 WCIFAWPSTTSTFTLALDSRF-FLGTFWSASTSFSYWCLF 14
           WC+F W +T + F+L     F  +G    A+T F+   LF
Sbjct: 256 WCVFFWATTPTLFSLCTFGLFALMGHQLDAATVFTCLALF 295


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,536,626
Number of Sequences: 28952
Number of extensions: 117901
Number of successful extensions: 279
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 276
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 279
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 829097472
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)