BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0408 (403 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16G5.14c |rps3||40S ribosomal protein S3|Schizosaccharomyces... 124 4e-30 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 25 4.4 >SPBC16G5.14c |rps3||40S ribosomal protein S3|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 124 bits (300), Expect = 4e-30 Identities = 73/125 (58%), Positives = 87/125 (69%), Gaps = 1/125 (0%) Frame = +2 Query: 20 AVNNISKKRKFVGDGVFKAELN*FLTRELAEDGYSGVEVRVTPIRSEIIIMATRTQSVLG 199 A ISKKRKFV DGVF AELN F TREL+E+GYSG EVRVTP RSEIII AT TQ VLG Sbjct: 3 AAFTISKKRKFVADGVFYAELNEFFTRELSEEGYSGCEVRVTPSRSEIIIRATHTQDVLG 62 Query: 200 EKGRRIRELTSVVQKRFNIQSNL*NCMLKR-WLLVVFALSPRPNL*DTSLSEVSLYRRAC 376 EKGRRIRELT++VQKRF N ++ + A++ +L L+ +++ RRA Sbjct: 63 EKGRRIRELTALVQKRFKFAENTVELYAEKVQNRGLCAVAQCESLRYKLLAGLAV-RRAA 121 Query: 377 YGVLR 391 YGVLR Sbjct: 122 YGVLR 126 Score = 60.9 bits (141), Expect = 7e-11 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = +1 Query: 259 EQSVELYAEKVATRGLCAIAQAESLRYKLIGGLAVPSCLLWCSPFIME 402 E +VELYAEKV RGLCA+AQ ESLRYKL+ GLAV ++ME Sbjct: 83 ENTVELYAEKVQNRGLCAVAQCESLRYKLLAGLAVRRAAYGVLRYVME 130 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 25.0 bits (52), Expect = 4.4 Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 7/71 (9%) Frame = -2 Query: 345 KLVS*RFGLGDSAKTTSSHLFSIQFYRLLWMLNRFCTTEVSS-------RILRPFSPSTL 187 K V+ + G D K + + +FYR L L++ E+S + RP+ + Sbjct: 533 KYVAEKSGCSDYRKILVTETYKGRFYRFLTQLSKSLLMEISEEDEIYLYELERPYEDGSD 592 Query: 186 CVLVAIIMISE 154 +LV + IS+ Sbjct: 593 DILVPVYHISD 603 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,660,862 Number of Sequences: 5004 Number of extensions: 30667 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 136158338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -