BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0402 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0662 + 5601147-5601176,5601419-5601517,5601601-5601651,560... 72 2e-13 03_06_0198 - 32299480-32299643,32300084-32300126,32300843-323009... 63 9e-11 10_06_0127 - 11027692-11027826,11027925-11027993,11029925-110300... 46 1e-05 08_02_0565 + 18751383-18751676,18751739-18751825,18752593-18752895 46 1e-05 11_03_0175 + 11241151-11241157,11241253-11241425,11241619-112417... 32 0.18 07_03_1568 - 27788314-27788619,27789125-27789294,27789868-277899... 28 3.0 10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290... 27 5.2 08_02_1069 - 24084393-24084410,24085232-24085387,24086485-240865... 27 5.2 05_01_0190 + 1366791-1366817,1367536-1367616,1367858-1367900,136... 27 5.2 03_05_0871 + 28396964-28399843 27 5.2 11_06_0685 - 26272928-26273110,26273186-26273257,26273339-262734... 27 6.9 11_06_0459 + 23830204-23830350,23830419-23830592,23830738-238308... 27 6.9 11_06_0276 - 21826458-21826640,21826716-21826787,21826869-218269... 27 6.9 06_01_0510 + 3681369-3681645,3682825-3682886,3683016-3683165,368... 27 6.9 05_01_0088 + 581619-581854,581890-582035,583143-583263,583593-58... 27 6.9 11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005,483... 27 9.1 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 27 9.1 >12_01_0662 + 5601147-5601176,5601419-5601517,5601601-5601651, 5602822-5602995,5603869-5603928,5604759-5604800 Length = 151 Score = 71.7 bits (168), Expect = 2e-13 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +1 Query: 232 KTEVDRRRHAVVTVRDAKHTNFVEFRNFKIVYRRYAXLVFCICVDVNDNNLXYLEAI 402 K +V+ H +V RD K TNFVEFR K++YRRYA L F +CVD+ DN L YLE I Sbjct: 37 KHKVEYEVHRLVVNRDPKFTNFVEFRTHKVIYRRYAGLFFSMCVDITDNELAYLECI 93 Score = 47.2 bits (107), Expect = 6e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = +2 Query: 149 KMIRFILIQNRAGKTRLAKWYMNFDDDEKQKL 244 + IRFIL+QNR GKTRLAK+Y+ +D EK K+ Sbjct: 9 QQIRFILLQNRQGKTRLAKYYVPLEDSEKHKV 40 >03_06_0198 - 32299480-32299643,32300084-32300126,32300843-32300929, 32301063-32301098,32301187-32301295,32301408-32301499, 32302029-32302115,32303887-32304222 Length = 317 Score = 63.3 bits (147), Expect = 9e-11 Identities = 27/57 (47%), Positives = 37/57 (64%) Frame = +1 Query: 232 KTEVDRRRHAVVTVRDAKHTNFVEFRNFKIVYRRYAXLVFCICVDVNDNNLXYLEAI 402 +T+V R ++ R K NFVE++ +K+VYRRYA L FC+C+D DN L LE I Sbjct: 139 RTKVIRELSGLILTRGPKLCNFVEWKGYKVVYRRYASLYFCMCIDAEDNELEVLEII 195 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 155 IRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEE 253 I F+L+ +R GK RL KWY + E+ K+I E Sbjct: 113 INFVLLISRQGKVRLTKWYSPYTQKERTKVIRE 145 >10_06_0127 - 11027692-11027826,11027925-11027993,11029925-11030011, 11030146-11030286 Length = 143 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = +1 Query: 292 NFVEFRNFKIVYRRYAXLVFCICVDVNDNNLXYLEAI 402 +FVE RN+K+VYRRYA L F + VD ++N L LE I Sbjct: 49 SFVEHRNYKVVYRRYASLFFLVGVDNDENELAILEFI 85 Score = 32.3 bits (70), Expect = 0.18 Identities = 12/30 (40%), Positives = 23/30 (76%) Frame = +2 Query: 155 IRFILIQNRAGKTRLAKWYMNFDDDEKQKL 244 IRF+++ N+ G+TR+A++Y + DE++ L Sbjct: 3 IRFVVMVNKQGQTRVAQYYEHLSVDERRAL 32 >08_02_0565 + 18751383-18751676,18751739-18751825,18752593-18752895 Length = 227 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = +1 Query: 292 NFVEFRNFKIVYRRYAXLVFCICVDVNDNNLXYLEAI 402 +FVE RN+K+VYRRYA L F + VD ++N L LE I Sbjct: 100 SFVEHRNYKVVYRRYASLFFLVGVDNDENELAILEFI 136 Score = 34.3 bits (75), Expect = 0.045 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = +2 Query: 155 IRFILIQNRAGKTRLAKWYMNFDDDEKQKL 244 IRF+L N+ G+TRLA++Y + DE++ L Sbjct: 3 IRFVLFVNKQGQTRLAQYYEHLSIDERRAL 32 >11_03_0175 + 11241151-11241157,11241253-11241425,11241619-11241702, 11242895-11242936,11243407-11243517,11245384-11245575, 11245776-11245859,11246162-11246259,11246670-11246859 Length = 326 Score = 32.3 bits (70), Expect = 0.18 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -1 Query: 195 RVLPARFWIKMNLIIFTFSY--GFFFKYYFQRRVDASF 88 R L R+W+K N+ I FSY +F+ +YF + AS+ Sbjct: 93 RSLKDRYWVKANIWIIIFSYVGNYFWTHYFFTVLGASY 130 >07_03_1568 - 27788314-27788619,27789125-27789294,27789868-27789979, 27790063-27790117,27790201-27790316,27790731-27790812, 27790974-27791228,27791326-27791454,27791539-27791747 Length = 477 Score = 28.3 bits (60), Expect = 3.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 203 KWYMNFD-DDEKQKLIEEGMQSSPSETRNTRTLSSSEISR*YTG 331 +W N+D +DEK +E + E ++ L +SEIS Y G Sbjct: 412 RWGQNYDSEDEKAAAVEAWISCHGKEPKSVIGLQASEISWDYEG 455 >10_07_0045 + 12328388-12328419,12328504-12328645,12328862-12329054, 12329224-12329320,12329404-12329528,12329616-12329734, 12331225-12331298,12331359-12331413,12331450-12331500, 12331611-12331857,12331940-12332036,12332170-12332244, 12334286-12334488,12334757-12334905,12334995-12335168, 12335276-12335401,12335493-12335623,12335743-12335818, 12335898-12336027,12336115-12336193,12336267-12336465, 12336591-12336698,12336769-12337025,12337267-12337282 Length = 984 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 94 LLFLKLVIRNLYLKFSDFNFDSYKIQ 17 LL ++ +N Y+KFS FD K++ Sbjct: 246 LLLFVILCKNFYIKFSSVEFDEIKME 271 >08_02_1069 - 24084393-24084410,24085232-24085387,24086485-24086560, 24086885-24086994 Length = 119 Score = 27.5 bits (58), Expect = 5.2 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +2 Query: 212 MNFDDDEKQKLIEEGMQSSPSETRNTRTLS--SSEISR 319 + F DD K ++ E S +NT++LS SS I+R Sbjct: 36 IRFQDDNKPLVLSESKNSEQENLKNTKSLSQLSSAIAR 73 >05_01_0190 + 1366791-1366817,1367536-1367616,1367858-1367900, 1368104-1368182,1368291-1368450,1368565-1368692, 1369134-1369202,1369796-1369883,1370516-1370591, 1370767-1370840,1372635-1372742,1373783-1373944, 1374179-1374283,1374447-1374527,1374603-1375803, 1376654-1376750,1378086-1378160,1378461-1378623 Length = 938 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 336 IPPVYYLEISELDKVRVFRVSDGDDCMP 253 +PPV+Y E+ L + F V+ G+ +P Sbjct: 157 VPPVFYCELCRLSRADPFWVTAGNPLLP 184 >03_05_0871 + 28396964-28399843 Length = 959 Score = 27.5 bits (58), Expect = 5.2 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 333 PPVYYLEISELDKVRVFRVSDG 268 P + YL+IS L K+RVF V +G Sbjct: 881 PELRYLKISGLKKLRVFHVGNG 902 >11_06_0685 - 26272928-26273110,26273186-26273257,26273339-26273425, 26273566-26273655,26273741-26273785,26273872-26274054, 26274333-26274392,26274521-26274703,26274779-26274907, 26275083-26275380,26275454-26275608,26275791-26275929, 26276015-26276096,26276167-26276285,26276367-26276494, 26276640-26276813,26276882-26277028 Length = 757 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 218 FDDDEKQKLIEEGMQSSPSETRNTRTLSSS 307 FD++ +K+ +E +++PS+ R TR +S Sbjct: 568 FDEEYNEKVTQESTKTNPSKRRVTRRFKTS 597 >11_06_0459 + 23830204-23830350,23830419-23830592,23830738-23830865, 23830947-23831065,23831136-23831217,23831303-23831441, 23831624-23831778,23831852-23832149,23832325-23832453, 23832529-23832711,23832840-23832899,23832973-23833101, 23833177-23833359,23833446-23833490,23833576-23833665, 23833806-23833892,23833974-23834045,23834120-23834302 Length = 800 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 218 FDDDEKQKLIEEGMQSSPSETRNTRTLSSS 307 FD++ +K+ +E +++PS+ R TR +S Sbjct: 611 FDEEYNEKVTQESTKTNPSKRRVTRRFKTS 640 >11_06_0276 - 21826458-21826640,21826716-21826787,21826869-21826955, 21827096-21827185,21827271-21827315,21827402-21827584, 21827660-21827788,21827862-21827921,21828050-21828232, 21828308-21828436,21828612-21828909,21828983-21829137, 21829320-21829458,21829544-21829625,21829696-21829814, 21829896-21830023,21830169-21830342,21830411-21830557 Length = 800 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 218 FDDDEKQKLIEEGMQSSPSETRNTRTLSSS 307 FD++ +K+ +E +++PS+ R TR +S Sbjct: 611 FDEEYNEKVTQESTKTNPSKRRVTRRFKTS 640 >06_01_0510 + 3681369-3681645,3682825-3682886,3683016-3683165, 3683776-3683952,3684496-3684711,3684802-3686480, 3686602-3686667,3686753-3686822,3686909-3687547 Length = 1111 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 263 TACLLLSTSVFRHHQNSYTISQVESCLL 180 T CL LS +++R Q+ TI+Q+E L Sbjct: 906 TECLSLSGTLYREMQHGETINQIEKLWL 933 >05_01_0088 + 581619-581854,581890-582035,583143-583263,583593-583773, 583842-584015,584161-584288,584370-584488,584559-584640, 584726-584864,585047-585201,585275-585572,585748-585876, 585952-586134,586263-586322,586396-586524,586600-586782, 586869-586913,586999-587088,587229-587315,587397-587468, 587813-587887 Length = 943 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 218 FDDDEKQKLIEEGMQSSPSETRNTRTLSSS 307 FD++ +K+ +E +++PS+ R TR +S Sbjct: 790 FDEEYNEKVTQESTKTNPSKRRVTRCFKTS 819 >11_01_0607 - 4837257-4837447,4837526-4837631,4837913-4838005, 4838405-4838542,4838651-4838778,4838889-4839049, 4839145-4839235,4841437-4841602 Length = 357 Score = 26.6 bits (56), Expect = 9.1 Identities = 21/70 (30%), Positives = 37/70 (52%) Frame = -2 Query: 293 FVCFASLTVTTACLLLSTSVFRHHQNSYTISQVESCLLGSGSK*ILSFSRLVMAFFLNIT 114 F+C+A++ V A +L+ V +H Q + + LLGS + ++S L +A L +T Sbjct: 141 FLCYAAIVVAAALVLIYFVVPQHGQTNIMVYIGVCSLLGSLT--VMSVKALGIA--LKLT 196 Query: 113 FKDGLTPPFF 84 F G+ F+ Sbjct: 197 F-SGVNQLFY 205 >06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 Length = 186 Score = 26.6 bits (56), Expect = 9.1 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -2 Query: 329 LYTILKFLNSTKFVCFASLTVTTACLLL-STSVFRHHQNSYTISQVESC-LLGSGSK 165 L T+ L ST+ C+ L A + S + + + +YT QV+SC LLG SK Sbjct: 110 LQTLQDALCSTRKDCYGDLLREGAAAYINSVAAKKQAKFAYTTQQVKSCILLGLTSK 166 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,494,382 Number of Sequences: 37544 Number of extensions: 184102 Number of successful extensions: 514 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -