BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0398 (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 7.7 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 7.7 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 21 7.7 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.7 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +2 Query: 2 EEKTENRWKDRNNFVKIPGRYFPLEI 79 E+ R+ D N +PG Y P + Sbjct: 394 EKFDPERFSDENKAKIVPGTYMPFGV 419 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 130 LTLGVDSECFRLIVTVVYF 74 LT V+ EC+++ VT+ F Sbjct: 256 LTTVVEKECYKMKVTIDAF 274 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 130 LTLGVDSECFRLIVTVVYF 74 LT V+ EC+++ VT+ F Sbjct: 182 LTTVVEKECYKMKVTIDAF 200 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 7.7 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 234 PRGIFSVSNSNSSKVCFM*WMSKMVTMSRCTGSASSHLGSTVSVFVSLSP 85 P GI + S S S + S + R TG+ + H +T S+ + SP Sbjct: 221 PTGIPTPSTSASPPTVNIKKESPQMQSYRPTGNITPHGSNTSSLITTPSP 270 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,494 Number of Sequences: 336 Number of extensions: 2260 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -