BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0398 (588 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 3.9 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 6.8 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 6.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.0 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.0 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 9.0 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -3 Query: 118 VDSECFRLIVTVVYFQREVSPRNLDKVIPVF 26 +D +CF+ I+ R+ + K +P+F Sbjct: 191 IDRQCFQTIMMRTGLSRQAEYTDFLKSVPIF 221 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 400 YPTAVRYLPRSRGVLK*KIY*WHPQFYFDS 311 + AV Y P ++ + IY +P ++FDS Sbjct: 144 FSIAVLYRPDTKYMKFPAIYEIYPNYFFDS 173 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 6.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 400 YPTAVRYLPRSRGVLK*KIY*WHPQFYFDS 311 + AV Y P ++ + IY +P ++FDS Sbjct: 144 FSIAVLYRPDTKYMKFPAIYEIYPNYFFDS 173 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 71 LEIDYGDNETKTLTVDPKCELAEPVQ 148 + + YG +LT+D + EL E +Q Sbjct: 62 IRLTYGQTNHISLTLDLEYELVENLQ 87 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 71 LEIDYGDNETKTLTVDPKCELAEPVQ 148 + + YG +LT+D + EL E +Q Sbjct: 100 IRLTYGQTNHISLTLDLEYELVENLQ 125 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.0 bits (42), Expect = 9.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 70 REVSPRNLDKVIPV 29 RE SPRNL+K + V Sbjct: 21 RENSPRNLEKSLNV 34 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,865 Number of Sequences: 438 Number of extensions: 2613 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -