BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0389 (667 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizos... 29 0.60 SPAC24H6.04 |hxk1||hexokinase 1 |Schizosaccharomyces pombe|chr 1... 26 4.2 SPAC1006.02 |||WD repeat protein, human GNB1L family|Schizosacch... 26 5.6 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 26 5.6 SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|... 25 9.8 >SPBC725.07 |pex5||peroxisomal targeting signal receptor |Schizosaccharomyces pombe|chr 2|||Manual Length = 598 Score = 29.1 bits (62), Expect = 0.60 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +3 Query: 87 NETDQLIDSSTQNYNVRDENTDNMNEMMKSATEHDP 194 ++TD ++++S Q +V +N D +E++K DP Sbjct: 261 SDTDNVVENSLQTEDVYSQNQDESSEVVKELNGIDP 296 >SPAC24H6.04 |hxk1||hexokinase 1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 484 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 156 MNEMMKSATEHDPLDKMLECCEFFKKLFGNKTTVQQ 263 M+ + SA E DP + + E F++ +G KTT ++ Sbjct: 342 MDTSVLSAIEVDPFENLDETQTLFEETYGLKTTEEE 377 >SPAC1006.02 |||WD repeat protein, human GNB1L family|Schizosaccharomyces pombe|chr 1|||Manual Length = 368 Score = 25.8 bits (54), Expect = 5.6 Identities = 11/31 (35%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = -2 Query: 342 HANVIAKTGIFDSFSYSP----AVICSAITF 262 H+N++ + F FSYSP V+C+ + F Sbjct: 122 HSNIVVNSLTFCPFSYSPQSKIVVLCNTLNF 152 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 25.8 bits (54), Expect = 5.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 390 LWHATKTNNIEPTANKHANVIAKT 319 ++HAT + P+ NKH+N T Sbjct: 549 IFHATCLQEVRPSENKHSNTNTST 572 >SPBC31E1.04 |pep12||SNARE Pep12|Schizosaccharomyces pombe|chr 2|||Manual Length = 317 Score = 25.0 bits (52), Expect = 9.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +3 Query: 84 INETDQLIDSSTQNYNVRDENTDNMNEMMKSATEH 188 INE +L+ + N NT N + ++ A EH Sbjct: 200 INEQGELVTNIEYNVGNTSTNTKNASRQLQIANEH 234 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,389,140 Number of Sequences: 5004 Number of extensions: 47498 Number of successful extensions: 119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -