BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0389 (667 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 24 1.5 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 3.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.6 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 8.0 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 466 SIMLRRTYXLKRTXXVSLTVRIXENLFLITNNQXPEQIDQM 588 +I+LRR Y + T V+LT+ + + L+T P ++M Sbjct: 236 NILLRRHYSMNSTTYVTLTI-VLMTMTLMTLWLEPSSTERM 275 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 331 NCENRYIRFILVFTGRYMFCDY 266 NC+N L+ RY+FC+Y Sbjct: 34 NCKNYDHPTTLLKLKRYLFCEY 55 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 4.6 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 319 GFRNYIGMFISSRFYVVRFCRMP*IKRDVSIW 414 G RNY+ F+S + R P + +++ W Sbjct: 335 GIRNYLTKFVSEYWMETRGFLQPVCQNEMNKW 366 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 277 FCDYICCTVVLFPNNFLKNSQHSNI 203 F Y+ V +P N +NS+ S I Sbjct: 168 FATYVDINYVEYPQNSKRNSEESAI 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,055 Number of Sequences: 438 Number of extensions: 3490 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -