BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0379 (390 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces p... 28 0.59 SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual 25 4.1 SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomy... 24 9.5 >SPBC83.07 |jmj3||Lid2 complex subunit Jmj3|Schizosaccharomyces pombe|chr 2|||Manual Length = 752 Score = 27.9 bits (59), Expect = 0.59 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 95 WPTGRGIYHNENKTFLVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKK 253 WP ++ + KT L W E L + + +GG Q Y + SA +E KK Sbjct: 195 WPNVGHLFAGKWKTTLPWRVESPELHAVQVHLGGSSLQWYV-IPSAHSESFKK 246 >SPCC645.10 |||ATP|Schizosaccharomyces pombe|chr 3|||Manual Length = 484 Score = 25.0 bits (52), Expect = 4.1 Identities = 7/12 (58%), Positives = 12/12 (100%) Frame = -1 Query: 228 LTSLLYTCCRSP 193 LTS++Y+CC++P Sbjct: 392 LTSVIYSCCKTP 403 >SPAC57A7.07c |||homocysteine methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 308 Score = 23.8 bits (49), Expect = 9.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 95 WPTGRGIYHNENKTF 139 +P GRG+Y N + TF Sbjct: 243 YPDGRGLYQNPDGTF 257 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 993,154 Number of Sequences: 5004 Number of extensions: 15639 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -