BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0375 (564 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00037-2|AAA50662.1| 212|Caenorhabditis elegans Hypothetical pr... 108 2e-24 AF140272-1|AAD34863.1| 212|Caenorhabditis elegans NADH oxidored... 108 2e-24 U53149-4|AAA96120.1| 956|Caenorhabditis elegans Patched related... 28 4.0 >U00037-2|AAA50662.1| 212|Caenorhabditis elegans Hypothetical protein T20H4.5 protein. Length = 212 Score = 108 bits (260), Expect = 2e-24 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = +3 Query: 267 MFWTELARGFAVTLAHIFKEPAXINYPFEKGPLXPRFRGEHALRRYPSXEERCIACKLCR 446 +F+TEL RGF V L H+F EPA INYPFEKGPL RFRGEHALRRYPS EERCIACKLC Sbjct: 61 VFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCE 120 Query: 447 S 449 + Sbjct: 121 A 121 Score = 57.2 bits (132), Expect = 8e-09 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 445 EAICPAQAIXIEAQERXDGSRXPLYXIFDXTKCLYCGFC 561 EAICPAQAI IEA+ R DGSR D TKC+YCG C Sbjct: 120 EAICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLC 158 >AF140272-1|AAD34863.1| 212|Caenorhabditis elegans NADH oxidoreductase complex I 23.8kDa subunit protein. Length = 212 Score = 108 bits (260), Expect = 2e-24 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = +3 Query: 267 MFWTELARGFAVTLAHIFKEPAXINYPFEKGPLXPRFRGEHALRRYPSXEERCIACKLCR 446 +F+TEL RGF V L H+F EPA INYPFEKGPL RFRGEHALRRYPS EERCIACKLC Sbjct: 61 VFFTELFRGFGVMLGHVFMEPATINYPFEKGPLSSRFRGEHALRRYPSGEERCIACKLCE 120 Query: 447 S 449 + Sbjct: 121 A 121 Score = 57.2 bits (132), Expect = 8e-09 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +1 Query: 445 EAICPAQAIXIEAQERXDGSRXPLYXIFDXTKCLYCGFC 561 EAICPAQAI IEA+ R DGSR D TKC+YCG C Sbjct: 120 EAICPAQAITIEAETRPDGSRRTTRYDIDMTKCIYCGLC 158 >U53149-4|AAA96120.1| 956|Caenorhabditis elegans Patched related family protein 1 protein. Length = 956 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 339 NYPFEKGPLXPRFRGEHALRRYPSXEERCIACKLCRS 449 N FE+ P FR + LR Y + + +CKL RS Sbjct: 709 NTTFEETPRITAFRFQLGLRNYRTPTDHTHSCKLMRS 745 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,907,789 Number of Sequences: 27780 Number of extensions: 229622 Number of successful extensions: 430 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1166125180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -