BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0375 (564 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 3.7 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 4.9 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +1 Query: 205 YVNAEEQDMSFRAMSDRQLRQCSGLS*PEDXXXXXXIFSR 324 Y+N + DM + + +RQC + ED FSR Sbjct: 80 YLNDTDMDMDLKDSIRKIIRQCVDNAKNEDKCLTAQKFSR 119 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 4.9 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 460 LDKWLLHSLQAMHLSSXEG*RRRACSPL-NRGXSGPF 353 LD W+ H L+ HL+ R +C L R + PF Sbjct: 113 LDTWVPHELKEKHLTQ----RINSCDLLKKRNENDPF 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,288 Number of Sequences: 438 Number of extensions: 2521 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -