BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0369 (589 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3140| Best HMM Match : C1_3 (HMM E-Value=7) 29 3.7 SB_38861| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) 28 4.9 SB_14979| Best HMM Match : 7tm_1 (HMM E-Value=8.8e-32) 28 4.9 SB_43831| Best HMM Match : 7tm_1 (HMM E-Value=0.0025) 28 4.9 SB_29529| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) 28 4.9 SB_4394| Best HMM Match : 7tm_1 (HMM E-Value=1.69978e-42) 28 4.9 SB_4393| Best HMM Match : 7tm_1 (HMM E-Value=6.40393e-43) 28 4.9 SB_4392| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-29) 28 4.9 >SB_3140| Best HMM Match : C1_3 (HMM E-Value=7) Length = 340 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -3 Query: 428 GTHYVN*EYTRSIFFSIQIEYQNLIEI-ISFSTVNTYLPVTRCSKLFFLN*H 276 G HY++ + R FF+++I +++ I S + Y TRC+ LF L H Sbjct: 235 GAHYLHCAFIRCTFFALRIHPVHILGIAYSPGAQSLYCAFTRCT-LFVLRIH 285 >SB_38861| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) Length = 432 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 152 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 184 >SB_14979| Best HMM Match : 7tm_1 (HMM E-Value=8.8e-32) Length = 271 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 214 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 246 >SB_43831| Best HMM Match : 7tm_1 (HMM E-Value=0.0025) Length = 276 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 159 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 191 >SB_29529| Best HMM Match : 7tm_1 (HMM E-Value=3.7e-23) Length = 269 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 152 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 184 >SB_4394| Best HMM Match : 7tm_1 (HMM E-Value=1.69978e-42) Length = 331 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 214 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 246 >SB_4393| Best HMM Match : 7tm_1 (HMM E-Value=6.40393e-43) Length = 521 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 214 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 246 >SB_4392| Best HMM Match : 7tm_1 (HMM E-Value=2.4e-29) Length = 505 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 204 VRKQS*DLKRVSVEICADDIQLRYTLIFVLCDY 106 VRK + R I A+DI++ TL+ ++C Y Sbjct: 206 VRKHKASITRSRTSISAEDIKITKTLVAIVCAY 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,882,747 Number of Sequences: 59808 Number of extensions: 228800 Number of successful extensions: 401 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 401 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -