BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0367 (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55992| Best HMM Match : 7tm_1 (HMM E-Value=7.6e-06) 32 0.49 SB_50834| Best HMM Match : GCR (HMM E-Value=2.5) 30 1.5 >SB_55992| Best HMM Match : 7tm_1 (HMM E-Value=7.6e-06) Length = 462 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 517 IFDYVLFQFY*CIENILKSS*CIFHTFLLMATL**SIIKCC 395 ++D +LF FY +E++++ C F F L I KCC Sbjct: 76 VYDLILFCFYHSMESVIRKLFCFFAYFCPKILLISCIFKCC 116 >SB_50834| Best HMM Match : GCR (HMM E-Value=2.5) Length = 909 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +2 Query: 413 SL*SCHQQKCMKNASRTFENIFNTSIKLEQNIVKYLY*NITINL*NRLSSQLIN 574 SL CH+++C SR +N + + NI ++ ++ N +L S L N Sbjct: 166 SLKECHKKRCPSTTSRLTDNSLDAHTSKDSNITEHAPVKLSKNQLRKLDSSLRN 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,473,067 Number of Sequences: 59808 Number of extensions: 301005 Number of successful extensions: 417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -