BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0367 (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79605-5|CAB01907.2| 316|Caenorhabditis elegans Hypothetical pr... 29 4.0 AL031627-17|CAA20950.2| 344|Caenorhabditis elegans Hypothetical... 28 5.3 U88311-5|AAB42343.1| 531|Caenorhabditis elegans Udp-glucuronosy... 28 7.0 AC024859-15|AAK29973.1| 277|Caenorhabditis elegans Hypothetical... 27 9.3 >Z79605-5|CAB01907.2| 316|Caenorhabditis elegans Hypothetical protein ZK678.6 protein. Length = 316 Score = 28.7 bits (61), Expect = 4.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = -3 Query: 548 FINLLLCFSKDI*LCSVP-ILLMY*KYSQKFLMHFSYIFADGNFIVINN 405 F N+LL F+ DI S+P ILL+Y + L + A G +V+ N Sbjct: 268 FNNMLLVFASDIFTLSLPFILLIYDSNVKSDLFRITKQSAPGTLLVLTN 316 >AL031627-17|CAA20950.2| 344|Caenorhabditis elegans Hypothetical protein Y102A5C.28 protein. Length = 344 Score = 28.3 bits (60), Expect = 5.3 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -2 Query: 207 LQETKYRKVLFYFTIQNNK**SQSLWCVCSFVFRYPNLFIIIKSGIFC 64 + E Y LFY TI N+ S L V +V +LF++I G+ C Sbjct: 173 VDEVAYTGRLFYSTIDNSLRYSAILTGVLQWVLTASSLFLVIFFGLRC 220 >U88311-5|AAB42343.1| 531|Caenorhabditis elegans Udp-glucuronosyltransferase protein25 protein. Length = 531 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +2 Query: 428 HQQKCMKNASRTFENIFNTSIKLEQNIVKY 517 H++K KNA + E + N +K ++ +VKY Sbjct: 435 HEEKYQKNARKLSELLNNQPLKPKEQVVKY 464 >AC024859-15|AAK29973.1| 277|Caenorhabditis elegans Hypothetical protein Y71H2AM.6 protein. Length = 277 Score = 27.5 bits (58), Expect = 9.3 Identities = 14/29 (48%), Positives = 22/29 (75%), Gaps = 1/29 (3%) Frame = +2 Query: 428 HQQKCMKNASRTFENIFNTSIKLE-QNIV 511 H+++ +K SR F NIFN S+KL+ +N+V Sbjct: 66 HREESLKPFSRHFPNIFN-SLKLDGENVV 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,109,458 Number of Sequences: 27780 Number of extensions: 264210 Number of successful extensions: 502 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -