BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0366 (437 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 3.9 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 3.9 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 5.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 6.8 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 3.9 Identities = 12/51 (23%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 112 CLSXTKADEQLV-NKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKRT 261 C +E ++ + + D + LK Y C+L K + + K K T Sbjct: 11 CAHVVFLEEYVIPDNIDIDDILSNERLLKNYVNCLLDKGRCTPEGKKLKST 61 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 3.9 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +1 Query: 154 LKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKRTSLW 270 LK +F E ALC + Q + G R LW Sbjct: 18 LKNAEFNGLPEEKLLDALCQSFRKQNSSSCGNGNRCDLW 56 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 Query: 348 PHQTAWNYVKCYHXKXPKXA 407 PH+ Y +C H K + A Sbjct: 484 PHELCDKYYRCVHGKPTEFA 503 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 20.6 bits (41), Expect = 6.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 129 FRLGETVGSVFLQVLLLLICE 67 ++L VGS L LLIC+ Sbjct: 3 YQLTACVGSAIAGFLFLLICD 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,396 Number of Sequences: 336 Number of extensions: 1252 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9775509 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -