BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0363 (610 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 110 7e-25 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.1 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.1 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 9.0 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 110 bits (265), Expect = 7e-25 Identities = 52/80 (65%), Positives = 67/80 (83%) Frame = +1 Query: 19 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 198 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 199 MPKLKAFQKIQIRLVRELER 258 +P+++AFQKIQ RLVRELE+ Sbjct: 68 VPQIRAFQKIQTRLVRELEK 87 Score = 48.0 bits (109), Expect = 6e-06 Identities = 23/35 (65%), Positives = 26/35 (74%) Frame = +3 Query: 255 KKFSGKHVVFXGDRXILPKPSHKTRVANKQKRPRS 359 KKFSGKHVV R ILP+P+ K+R KQKRPRS Sbjct: 87 KKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +1 Query: 55 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 222 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 107 PTSKPNFGSFTLQKLKKLNYTIRS 178 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 9.0 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +2 Query: 86 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 184 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,597,549 Number of Sequences: 59808 Number of extensions: 247069 Number of successful extensions: 523 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -