BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0348 (631 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.69 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.69 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.69 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.69 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 4.9 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 6.4 AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 8.5 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 8.5 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.69 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 108 LYDLYVSIFTYIFGICCCSIL 46 L +++ S F YIFG C I+ Sbjct: 382 LINIFASYFAYIFGKFACKIM 402 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.69 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 108 LYDLYVSIFTYIFGICCCSIL 46 L +++ S F YIFG C I+ Sbjct: 382 LINIFASYFAYIFGKFACKIM 402 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.69 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 108 LYDLYVSIFTYIFGICCCSIL 46 L +++ S F YIFG C I+ Sbjct: 382 LINIFASYFAYIFGKFACKIM 402 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.69 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 108 LYDLYVSIFTYIFGICCCSIL 46 L +++ S F YIFG C I+ Sbjct: 382 LINIFASYFAYIFGKFACKIM 402 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 Query: 264 GVLDVSNSFAVPFDEDDKDKSV 329 G L+ ++ + P D+DDKD+ + Sbjct: 225 GSLEDDDNISDPEDDDDKDQDM 246 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 6.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 402 CWLVHTGPKLHQNDIXLNEXIRRYCPNSXLVIIDANLKILV 524 CW+V G L L + + Y L++ + LKILV Sbjct: 135 CWIVEIGGWLAFTKQLLIKFVEVYPLFVLLIVSNVVLKILV 175 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.0 bits (42), Expect = 8.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 315 KDKSVWFLDHDYLENMYGMFKKV 383 K KS + HD L N+Y K V Sbjct: 6 KVKSYFTTHHDTLHNIYTSMKPV 28 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.0 bits (42), Expect = 8.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 315 KDKSVWFLDHDYLENMYGMFKKV 383 K KS + HD L N+Y K V Sbjct: 6 KVKSYFTTHHDTLHNIYTSMKPV 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,830 Number of Sequences: 336 Number of extensions: 2677 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -