BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0348 (631 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1468 + 33811471-33811657,33811888-33811980,33812899-338130... 72 3e-13 05_01_0034 - 228939-229028,229117-229230,229309-229430,229827-23... 31 1.00 03_02_0281 - 7069847-7069876,7070152-7070218,7071320-7071445,707... 29 3.0 01_05_0494 + 22701994-22703117,22703526-22703580 29 4.0 01_04_0136 + 16506747-16506982,16507128-16507728,16510443-165108... 29 4.0 02_02_0241 - 8204430-8205398 28 7.0 07_03_0265 + 15976331-15976645,15977575-15977784,15977869-159779... 27 9.3 >04_04_1468 + 33811471-33811657,33811888-33811980,33812899-33813027, 33813089-33813166,33813377-33813435,33813522-33813644, 33814225-33814282,33814383-33814468,33814564-33814635 Length = 294 Score = 72.1 bits (169), Expect = 3e-13 Identities = 30/62 (48%), Positives = 47/62 (75%), Gaps = 3/62 (4%) Frame = +3 Query: 210 NRESETSSRCSIGLL---RAKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKK 380 NR + + + +G+L ++G +DV+NS+AVPF+EDDKD +WFLDH+Y E+M+ MFK+ Sbjct: 32 NRVARDTRKRVVGVLLGTSSRGSVDVTNSYAVPFEEDDKDPRIWFLDHNYHESMFSMFKR 91 Query: 381 VN 386 +N Sbjct: 92 IN 93 >05_01_0034 - 228939-229028,229117-229230,229309-229430,229827-230056, 230458-230537,230641-230859 Length = 284 Score = 30.7 bits (66), Expect = 1.00 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 243 IGLLRAKGVLDVSNSFAVPFDEDDKDKSVWFLDHDYLENMYGMFKKVN 386 +G + G + V NS+ VP +E + LD +Y NMY KVN Sbjct: 48 LGSVLPDGTVHVRNSYVVPHNESPDQVA---LDIEYHHNMYASHHKVN 92 >03_02_0281 - 7069847-7069876,7070152-7070218,7071320-7071445, 7071727-7071916,7072008-7072110 Length = 171 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = -1 Query: 337 RNQTDLSLSSSSNGTAKLFDTSKTPLALNNPIEHRLLVSDSRFYSC 200 RN D SL S +G F L P++ RLL DSR +SC Sbjct: 97 RNFKDKSLRSPLSGPEAFFSEEMQD-KLWGPLDMRLLPVDSRIFSC 141 >01_05_0494 + 22701994-22703117,22703526-22703580 Length = 392 Score = 28.7 bits (61), Expect = 4.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 390 QGKSCWLVHTGPKLHQ 437 QG CW H GP+L+Q Sbjct: 182 QGSKCWFPHRGPRLNQ 197 >01_04_0136 + 16506747-16506982,16507128-16507728,16510443-16510842, 16513595-16513709,16513776-16514352 Length = 642 Score = 28.7 bits (61), Expect = 4.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 470 TPNXLI*XYVILMKFRSSVDQPTTFSLAVNLFEHTIH 360 TPN I YV+L F + +D+ + F L + E H Sbjct: 106 TPNLSIPDYVLLQHFHTGLDKESAFHLNITAGESFFH 142 >02_02_0241 - 8204430-8205398 Length = 322 Score = 27.9 bits (59), Expect = 7.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -1 Query: 346 SWSRNQTDLSLSSSSNGTAKLFDTSKTPLALNNPIEHRLLVSDSR 212 +WS + L ++S +G+ +LFD + P NP+ RLL +R Sbjct: 72 AWSESHESLCAAASGDGSVRLFDVALPP--AQNPV--RLLREHAR 112 >07_03_0265 + 15976331-15976645,15977575-15977784,15977869-15977916, 15978307-15978675,15978736-15978747,15978763-15978870, 15979156-15979493,15980313-15980430,15983247-15984107, 15984457-15984750 Length = 890 Score = 27.5 bits (58), Expect = 9.3 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = -1 Query: 346 SWSRNQTDLSLSSSSNGTAKLFDTSKTPLALNNPIEHRLLVSDSRFYSCG 197 SW + L S+GT TS + + H LLV DS YSCG Sbjct: 81 SWKKVLRFLQSVEQSSGTVH---TSSGNMQVATGRYHTLLVHDSSVYSCG 127 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,765,457 Number of Sequences: 37544 Number of extensions: 262170 Number of successful extensions: 511 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1537558360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -