BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0338 (661 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021283-1|AAX33431.1| 1272|Drosophila melanogaster RE34808p pro... 28 9.8 AY084167-1|AAL89905.1| 947|Drosophila melanogaster RE40762p pro... 28 9.8 AE014134-3594|AAF45346.2| 1272|Drosophila melanogaster CG17018-P... 28 9.8 AE014134-3593|AAN10334.2| 1305|Drosophila melanogaster CG17018-P... 28 9.8 AE014134-3592|AAN10333.2| 1294|Drosophila melanogaster CG17018-P... 28 9.8 >BT021283-1|AAX33431.1| 1272|Drosophila melanogaster RE34808p protein. Length = 1272 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 274 IKLPTIFQFYA*SVEIRSQYFV*GTNLKSVHL*TASYNSKTHRYSASVGSGNGMNIAV 101 + LP F S + Y ++KS+HL +S+NS + +AS+G+G+ NI++ Sbjct: 1084 LSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSFNS-SGELNASLGAGDLTNISL 1140 >AY084167-1|AAL89905.1| 947|Drosophila melanogaster RE40762p protein. Length = 947 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 274 IKLPTIFQFYA*SVEIRSQYFV*GTNLKSVHL*TASYNSKTHRYSASVGSGNGMNIAV 101 + LP F S + Y ++KS+HL +S+NS + +AS+G+G+ NI++ Sbjct: 759 LSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSFNS-SGELNASLGAGDLTNISL 815 >AE014134-3594|AAF45346.2| 1272|Drosophila melanogaster CG17018-PA, isoform A protein. Length = 1272 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 274 IKLPTIFQFYA*SVEIRSQYFV*GTNLKSVHL*TASYNSKTHRYSASVGSGNGMNIAV 101 + LP F S + Y ++KS+HL +S+NS + +AS+G+G+ NI++ Sbjct: 1084 LSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSFNS-SGELNASLGAGDLTNISL 1140 >AE014134-3593|AAN10334.2| 1305|Drosophila melanogaster CG17018-PD, isoform D protein. Length = 1305 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 274 IKLPTIFQFYA*SVEIRSQYFV*GTNLKSVHL*TASYNSKTHRYSASVGSGNGMNIAV 101 + LP F S + Y ++KS+HL +S+NS + +AS+G+G+ NI++ Sbjct: 1117 LSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSFNS-SGELNASLGAGDLTNISL 1173 >AE014134-3592|AAN10333.2| 1294|Drosophila melanogaster CG17018-PC, isoform C protein. Length = 1294 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -1 Query: 274 IKLPTIFQFYA*SVEIRSQYFV*GTNLKSVHL*TASYNSKTHRYSASVGSGNGMNIAV 101 + LP F S + Y ++KS+HL +S+NS + +AS+G+G+ NI++ Sbjct: 1106 LSLPNSFGSSLESGSFSNSYSNKENSMKSLHLFNSSFNS-SGELNASLGAGDLTNISL 1162 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,629,663 Number of Sequences: 53049 Number of extensions: 495270 Number of successful extensions: 820 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 814 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2827453950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -