BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0336 (653 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1D1B3 Cluster: Putative uncharacterized protein; n=1; ... 35 1.5 UniRef50_A7KAJ9 Cluster: Atg15p; n=1; Pichia angusta|Rep: Atg15p... 34 3.4 >UniRef50_Q1D1B3 Cluster: Putative uncharacterized protein; n=1; Myxococcus xanthus DK 1622|Rep: Putative uncharacterized protein - Myxococcus xanthus (strain DK 1622) Length = 555 Score = 35.1 bits (77), Expect = 1.5 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = -1 Query: 224 PTFAPTLFSRCTRWASGVGAYVGANVWSRRQR 129 P AP L S C W G GA +GA +W RR+R Sbjct: 520 PEPAPRLPSSCWGWMGGAGAGLGAWLWRRRRR 551 >UniRef50_A7KAJ9 Cluster: Atg15p; n=1; Pichia angusta|Rep: Atg15p - Pichia angusta (Yeast) (Hansenula polymorpha) Length = 536 Score = 33.9 bits (74), Expect = 3.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +3 Query: 228 LAVECGCSRLSTCWGFAQSCCNTRQVCMSRCLHQQTRHP 344 L C C+R+S+ W C C CL Q+ R P Sbjct: 242 LLFSCCCARVSSLWKTVCDCYEESYTCNQNCLEQELRRP 280 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,730,645 Number of Sequences: 1657284 Number of extensions: 10082959 Number of successful extensions: 24710 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24699 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49173558301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -