BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0325 (313 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 5e-19 SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-13 SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) 69 6e-13 SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-12 SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) 68 2e-12 SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-12 SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 2e-12 SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) 68 2e-12 SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-12 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 66 4e-12 SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) 66 7e-12 SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) 65 1e-11 SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) 65 1e-11 SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) 65 1e-11 SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) 65 1e-11 SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) 65 1e-11 SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) 65 1e-11 SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) 65 1e-11 SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) 65 1e-11 SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) 65 1e-11 SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) 65 1e-11 SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-11 SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) 65 1e-11 SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) 64 2e-11 SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) 64 2e-11 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 57 3e-09 SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.012 SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.19 SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) 29 1.0 SB_16126| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) 27 3.1 SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) 27 3.1 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.1 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 26 5.4 SB_49797| Best HMM Match : CAV_VP3 (HMM E-Value=9) 26 7.2 SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 26 7.2 SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) 26 7.2 SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_53115| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_34878| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) 26 7.2 SB_33350| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) 26 7.2 SB_9192| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.2 SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.5 SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 25 9.5 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 25 9.5 SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) 25 9.5 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 89.4 bits (212), Expect = 5e-19 Identities = 44/55 (80%), Positives = 47/55 (85%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKE 166 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGV + I ++ Sbjct: 138 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVYQKLKNPSISQD 192 >SB_56326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 70.1 bits (164), Expect = 3e-13 Identities = 34/60 (56%), Positives = 45/60 (75%), Gaps = 1/60 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKEGGSG 178 ELAGNA++D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ K+ +G Sbjct: 28 ELAGNAARDNKKSRIVPRHLQLAVRNDEELNKLLQGVTIAQGGVLPNIQAVLLPKKSNTG 87 >SB_32212| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 69.3 bits (162), Expect = 6e-13 Identities = 35/56 (62%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ ATIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGATIAQGGVLPNIQASLLPKK 119 >SB_56156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 67.7 bits (158), Expect = 2e-12 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKEGGSG 178 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKKTEKK 123 Query: 179 APPFK 193 A P K Sbjct: 124 AAPGK 128 >SB_54197| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_32396| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_31835| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_29633| Best HMM Match : Histone (HMM E-Value=5.3e-31) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_28838| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_14747| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_54382| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_45182| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_42476| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_25226| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_19336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_11028| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_9842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8583| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_8319| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_7498| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 67.7 bits (158), Expect = 2e-12 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_3888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 986 Score = 67.3 bits (157), Expect = 2e-12 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKEGG 172 ELAGNA++D K RI PRH+ LA+ DEEL L+K TIA GGV+P+IH L+ K G Sbjct: 699 ELAGNAARDNKKTRIIPRHILLAVANDEELHKLLKGVTIASGGVLPNIHPELLKKRKG 756 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 66.5 bits (155), Expect = 4e-12 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L++ TIA GGV+P+I L+ K+ Sbjct: 801 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLRGVTIAQGGVLPNIQAVLLPKK 856 >SB_48204| Best HMM Match : Histone (HMM E-Value=2.7e-32) Length = 125 Score = 65.7 bits (153), Expect = 7e-12 Identities = 34/56 (60%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA+ D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I SL+ K+ Sbjct: 64 ELAGNAACDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119 >SB_55462| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_46252| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 134 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 72 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 127 >SB_5065| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 330 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 434 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 489 >SB_54707| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_31727| Best HMM Match : Histone (HMM E-Value=5e-33) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_31723| Best HMM Match : Histone (HMM E-Value=0.016) Length = 76 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 14 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 69 >SB_28189| Best HMM Match : Histone (HMM E-Value=1.5e-12) Length = 90 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 28 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 83 >SB_26809| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_25701| Best HMM Match : Histone (HMM E-Value=4.8e-33) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_24673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_18628| Best HMM Match : Histone (HMM E-Value=1.5e-31) Length = 126 Score = 65.3 bits (152), Expect = 1e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQAVLLPKK 119 >SB_1956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 64.9 bits (151), Expect = 1e-11 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGK 163 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK 118 >SB_38873| Best HMM Match : Histone (HMM E-Value=2.6e-33) Length = 125 Score = 64.9 bits (151), Expect = 1e-11 Identities = 33/55 (60%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLI-KATIAGGGVIPHIHKSLIGK 163 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV+P+I L+ K Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK 118 >SB_55892| Best HMM Match : Histone (HMM E-Value=9.4e-33) Length = 125 Score = 64.5 bits (150), Expect = 2e-11 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA G V+P+I SL+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGRVLPNIQASLLPKK 119 >SB_57971| Best HMM Match : Histone (HMM E-Value=5.4e-33) Length = 125 Score = 64.1 bits (149), Expect = 2e-11 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGVIPHIHKSLIGKE 166 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TI+ GGV+P+I L+ K+ Sbjct: 64 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTISQGGVLPNIQAVLLPKK 119 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 56.8 bits (131), Expect = 3e-09 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +2 Query: 2 ELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIK-ATIAGGGV 130 ELAGNA++D K RI PRHLQLA+R DEEL+ L+ TIA GGV Sbjct: 11 ELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGV 54 >SB_50166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 35.1 bits (77), Expect = 0.012 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +2 Query: 65 LAIRGDEELDSLIKA-TIAGGGVIPHIHKSLIGK 163 LA+R DEEL+ L+ TIA GGV+P+I L+ K Sbjct: 1 LAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPK 34 >SB_43621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 31.1 bits (67), Expect = 0.19 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 211 SSSXLKFKRGCTRPAFFPNERFVYVWDDASASDS 110 SSS + +G +P FFP+ F+ WD +DS Sbjct: 646 SSSSYQPAKGLEQPGFFPSSNFLLAWDIPLINDS 679 >SB_20073| Best HMM Match : F5_F8_type_C (HMM E-Value=2.9e-18) Length = 593 Score = 28.7 bits (61), Expect = 1.0 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 44 ITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKEGGSG 178 +T +H+ + R + LIK + G H+H+ L G+ +G Sbjct: 207 LTAKHINITNRTANVVKKLIKIGLLTNGSTTHVHRFLKGQRNNTG 251 >SB_16126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1056 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 129 TPPPAIVAFMRLSNSSSPLIASC 61 +PPPA +F+RL + +S L SC Sbjct: 965 SPPPACGSFVRLPDDNSNLTRSC 987 >SB_54878| Best HMM Match : PAP_assoc (HMM E-Value=5.4e-18) Length = 1425 Score = 27.1 bits (57), Expect = 3.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 108 QLSLAEASSHTYTNLSLGKKAGLVHPRLNFKXED 209 Q+S A S+ T + G + G HPR+N+ +D Sbjct: 827 QVSSAFISAQAQTQGAEGSRQGATHPRMNWMAKD 860 >SB_9414| Best HMM Match : 7tm_1 (HMM E-Value=0.051) Length = 334 Score = 27.1 bits (57), Expect = 3.1 Identities = 10/37 (27%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -2 Query: 138 CGMTPPPAIVAFMRLSNSSSPLIASCKC--RGVIRFT 34 CG +P A+V+ RL ++ ++ C C R +++++ Sbjct: 265 CGCSPLIAMVSMKRLKRATKRIVCMCLCPERAILKYS 301 >SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1329 Score = 26.6 bits (56), Expect = 4.1 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 177 PDPPSFPMRDLCMCGMTPPPAIVAFMRLSNSSS 79 P P F R + PPPA + RLS+ SS Sbjct: 680 PPSPGFSRRTIIPDDFPPPPADLTTSRLSSQSS 712 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 86 ELDSLIKATIAGGGVIPHIHKSLIGKEG 169 ++ S++K TI+ + H+H +IG +G Sbjct: 307 DMKSMLKLTISIASGLAHLHMEIIGTQG 334 >SB_49797| Best HMM Match : CAV_VP3 (HMM E-Value=9) Length = 171 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 49 APRPPGEPLPDWCKCG 64 >SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 20 SKDLKVKRITPRHLQLAIRGDEELD-SLIKATIAGGGVIPHIHKSLIG 160 +K + +K++TP L + + I ++GGGV+P + +S+ G Sbjct: 25 AKVINLKKVTPTRAPLGPSAHPNMPRNKIGLALSGGGVMPILLQSIAG 72 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +1 Query: 103 KSNYRWRRRHPTHTQISHWERRR----VWCT 183 K NY +RR P T+ +++ +RR WCT Sbjct: 55 KGNYYRKRRCPPLTKCTNYRKRRCPPLTWCT 85 >SB_58219| Best HMM Match : SOCS_box (HMM E-Value=2e-07) Length = 507 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 Query: 267 NDLCSVLRRPGYQNAVYFGHLXT*NLNGGAPDPPSFPMRDL 145 N++C VL G A + L N+ G DPP P+R L Sbjct: 195 NNMCDVLN--GNIRANHGSELVAGNVLPGLRDPPPLPLRPL 233 >SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 25.8 bits (54), Expect = 7.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 126 PPPAIVAFMRLSNSSSPLIASCKCRGV 46 PPPA +F+RL +S L +C G+ Sbjct: 141 PPPACGSFVRLPGENSTLTQNCGKWGI 167 >SB_53115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 49 APRPPGEPLPDWCKCG 64 >SB_34878| Best HMM Match : 7tm_1 (HMM E-Value=6e-08) Length = 1383 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 Query: 144 CMCGMTPPPAIVAFMRLSNSSSPLIASCKCRGVI 43 C C PPP + + + SPL S RGV+ Sbjct: 349 CFCRYAPPPYVRDDVLVIGIDSPLSGSNGIRGVV 382 >SB_33350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 49 APRPPGEPLPDWCKCG 64 >SB_31205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1528 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 1424 APRPPGEPLPDWCKCG 1439 >SB_20225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1548 Score = 25.8 bits (54), Expect = 7.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 180 APDPPSFPMRDLCMCGMTPPPAIVAFMRLSNSSSP 76 AP P R + + PPPAI A + LS +SSP Sbjct: 1061 APPEDKPPARRRKVSAVAPPPAIFASL-LSQASSP 1094 >SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1520 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 176 APRPPGEPLPDWCKCG 191 >SB_9192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 180 APDPPSFPMRDLCMCG 133 AP PP P+ D C CG Sbjct: 131 APRPPGEPLPDWCKCG 146 >SB_6387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 25.8 bits (54), Expect = 7.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +3 Query: 132 SHTYTNLSLGKKAGLVHPRLNFKXEDDQNILHF 230 S+ Y ++ +G K HPRL FK + ++ HF Sbjct: 163 SYKYCDMYIGFKRNH-HPRLGFKVKPGKHTAHF 194 >SB_43455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 25.4 bits (53), Expect = 9.5 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +2 Query: 62 QLAIRGDEELDSLIKATI 115 +L I G+E+LDSLI++T+ Sbjct: 567 ELVIFGEEQLDSLIESTL 584 >SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 291 Score = 25.4 bits (53), Expect = 9.5 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 58 LTTC-Y*RR*RIGQPHKSNYRWRRRHPTHTQISHWERRRVWCTPV 189 LT C Y R+ R + K Y +RR P T+ +++ +RR C P+ Sbjct: 199 LTKCNYYRKRRCPRLTKCTYYLKRRCPPLTKCTNYRKRR--CPPL 241 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 25.4 bits (53), Expect = 9.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 183 GAPDPPSFPMRDLCMCGMTPPP 118 GAP PPS M + G PPP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPP 365 >SB_30541| Best HMM Match : PSI_PsaJ (HMM E-Value=4) Length = 368 Score = 25.4 bits (53), Expect = 9.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 Query: 128 VIPHIHKSLIGKEGG 172 V PH+HK+L+G + G Sbjct: 37 VFPHLHKALLGAKAG 51 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,514,296 Number of Sequences: 59808 Number of extensions: 225264 Number of successful extensions: 629 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 585 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 387973711 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -