BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0320 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 25 0.43 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.0 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 9.3 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 25.4 bits (53), Expect = 0.43 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 328 MKIRFCIFIHSRRINRCNFSQF 393 M R CI I S R N NFS+F Sbjct: 1 MSTRICIPISSGRTNGSNFSKF 22 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +2 Query: 557 TIFXWSKYXHFFHXNFLRFSLGNYLGRYSRLSQ 655 T+ + Y HFF+ L L RY L++ Sbjct: 151 TVEYFQNYIHFFYQLLLYLITDMILMRYKELNR 183 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 Query: 503 PLLQAFH*ILIY*KFNFFTIFXWSKYXH 586 P+LQ F I Y + + WS H Sbjct: 131 PVLQLFLYIFTYLSVTCYVTYAWSPIDH 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,129 Number of Sequences: 336 Number of extensions: 1823 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -