BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0316 (372 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 64 2e-11 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 63 5e-11 At2g47550.1 68415.m05934 pectinesterase family protein contains ... 28 1.7 At4g19515.1 68417.m02871 disease resistance family protein simil... 28 2.3 At5g46540.1 68418.m05730 ABC transporter family protein contains... 27 4.0 At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain... 26 7.0 At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-contai... 26 9.2 At2g33990.1 68415.m04162 calmodulin-binding family protein simil... 26 9.2 At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain... 26 9.2 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 64.5 bits (150), Expect = 2e-11 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +2 Query: 2 DKVQEINXTKQAVIFLRRLKAWSDILXVYKSQRLRAGKGKMRNRRRIQRKGPLIIFNKDQ 181 D + + T A+ L+++ A+ D S +R GKGKMRNRR I RKGPL++F + Sbjct: 162 DSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVFGTEG 221 Query: 182 G-LTRAFRNIPG 214 + +AFRN+PG Sbjct: 222 AKIVKAFRNLPG 233 Score = 50.8 bits (116), Expect = 3e-07 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 268 HLGRFVIWTQSAFGRLDPLFGSWKTPSKQKKNFNL 372 HLGRFVIWT+SAF +L+ ++GS++ PS++KK + L Sbjct: 252 HLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVL 286 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 63.3 bits (147), Expect = 5e-11 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Frame = +2 Query: 2 DKVQEINXTKQAVIFLRRLKAWSDILXVYKSQRLRAGKGKMRNRRRIQRKGPLIIFNKD- 178 D + + T A+ L+++ A+ D S +R GKGKMRNRR I RKGPL+++ + Sbjct: 161 DSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYISRKGPLVVYGTEG 220 Query: 179 QGLTRAFRNIPG 214 + +AFRN+PG Sbjct: 221 SKIVKAFRNLPG 232 Score = 50.8 bits (116), Expect = 3e-07 Identities = 20/35 (57%), Positives = 30/35 (85%) Frame = +1 Query: 268 HLGRFVIWTQSAFGRLDPLFGSWKTPSKQKKNFNL 372 HLGRFVIWT+SAF +L+ ++GS++ PS++KK + L Sbjct: 251 HLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYVL 285 >At2g47550.1 68415.m05934 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 560 Score = 28.3 bits (60), Expect = 1.7 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = -3 Query: 244 VQLVNIQELHTGDVAESASQTLILVED--YEGSLTLDTTTVAHFTLTSTKTLRLVHGKDI 71 + +++ + G VA A T+ +ED + SLT+D + T STKTL L +D+ Sbjct: 78 ISMIDAELDRKGKVA--AKSTVGALEDCKFLASLTMDYLLSSSQTADSTKTLSLSRAEDV 135 Query: 70 RPCLEA 53 L A Sbjct: 136 HTFLSA 141 >At4g19515.1 68417.m02871 disease resistance family protein similar to downy mildew resistance protein RPP5 [Arabidopsis thaliana] GI:6449046; contains Pfam profile PF01582: TIR domain Length = 524 Score = 27.9 bits (59), Expect = 2.3 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = -3 Query: 247 EVQLVNIQELHTGDVAESASQTLILVEDYEGSLTLDTTTVAHFTLTSTKTLRLVHGK 77 E+ VN QE+H GD + ++ D GS + +T T +S +L+L+ GK Sbjct: 101 EIFPVNKQEMHVGDSCTITKCGVYVINDAAGSSSGNTMTP---QCSSMDSLKLLDGK 154 >At5g46540.1 68418.m05730 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1248 Score = 27.1 bits (57), Expect = 4.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 190 SQTLILVEDYEGSLTLDTTTVAHFTLTSTKTLRLVHGKDI 71 S TL G ++LD T H ++STKT + GK++ Sbjct: 628 SGTLTSPSGLPGVISLDQTEEFHENISSTKTQTVKKGKEV 667 >At4g32070.1 68417.m04564 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 811 Score = 26.2 bits (55), Expect = 7.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 112 TSTKTLRLVHGKDIR 68 T T+T++LVHG DIR Sbjct: 315 TVTRTIKLVHGDDIR 329 >At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-containing protein similar to SNM1 protein [Mus musculus] GI:7595835; contains Pfam profile PF00536: SAM domain (Sterile alpha motif) Length = 723 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 220 LHTGDVAESASQTLILVEDYEGSLTLDTT 134 LHTGD S + L+ + SL LDTT Sbjct: 502 LHTGDFRYSEEMSNWLIGSHISSLILDTT 530 >At2g33990.1 68415.m04162 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 249 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +2 Query: 32 QAVIFLRRLKAWSDILXVYKSQRL-RAGKGKMRNRR 136 QAV+ LR L +WS I K++R+ + +++N+R Sbjct: 87 QAVVTLRYLHSWSKIQSEIKARRVCMVTEWRLKNKR 122 >At2g25290.1 68415.m03025 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 697 Score = 25.8 bits (54), Expect = 9.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 112 TSTKTLRLVHGKDIR 68 T T+T++LVHG DIR Sbjct: 278 TVTRTVKLVHGDDIR 292 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,048,245 Number of Sequences: 28952 Number of extensions: 106742 Number of successful extensions: 317 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 317 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -