BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0305 (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0194 + 15319764-15319982,15320377-15320481,15320523-15320621 28 4.8 01_06_1588 + 38474698-38477169 27 6.4 12_01_0156 + 1188143-1189957 27 8.5 >03_03_0194 + 15319764-15319982,15320377-15320481,15320523-15320621 Length = 140 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 391 CNILRYNHDIV*INTSELFNTNEVWNGWVGLCVYKK 284 C I HD+ I++S F + W G+C++KK Sbjct: 99 CYIYESKHDL--ISSSNKFGAKFLMGTWCGVCMWKK 132 >01_06_1588 + 38474698-38477169 Length = 823 Score = 27.5 bits (58), Expect = 6.4 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 313 GWVGLCVYKKRACFGSFSWYISHNSRLFGEGC 218 GW GLCVY R Y+ ++ G+GC Sbjct: 295 GWNGLCVYTPRPACSCPPGYVPADAGDRGKGC 326 >12_01_0156 + 1188143-1189957 Length = 604 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -3 Query: 258 GTFHIIP-GCLVRAVAFVGQASVNQLLYFQFV 166 GTFH P GCL+ +A + + N+LL+F V Sbjct: 218 GTFHGKPSGCLMYELAHALRKNTNELLWFACV 249 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,754,936 Number of Sequences: 37544 Number of extensions: 252089 Number of successful extensions: 553 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -