BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0297 (370 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 4.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 20 8.1 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 20 8.1 AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin prot... 20 8.1 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 20 8.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 20 8.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 4.6 Identities = 10/24 (41%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = -1 Query: 208 TSQKA-VCVQHTQHPRPGFPPPLP 140 T QK + Q +Q P G P P P Sbjct: 2 TQQKQPIITQQSQQPSSGAPGPQP 25 Score = 20.6 bits (41), Expect = 6.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 Query: 229 SSNTSARTSQKAVCVQHTQHPRPGFPPPLP 140 S + S + Q+ +Q P PG PP P Sbjct: 26 SPHQSPQAPQRGSPPNPSQGPPPGGPPGAP 55 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 20.2 bits (40), Expect = 8.1 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -3 Query: 215 CANITESGLCPAHATSAARLPTST 144 C + GLCP R+P T Sbjct: 446 CCFAQDDGLCPYTLKHKIRVPPGT 469 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 239 LGRVQPNRPLGWYNTR 286 LG + P+G+Y TR Sbjct: 175 LGEWEKRAPMGFYGTR 190 >AB073996-1|BAC76400.1| 215|Apis mellifera preprotachykinin protein. Length = 215 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 239 LGRVQPNRPLGWYNTR 286 LG + P+G+Y TR Sbjct: 175 LGEWEKRAPMGFYGTR 190 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 20.2 bits (40), Expect = 8.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 239 LGRVQPNRPLGWYNTR 286 LG + P+G+Y TR Sbjct: 175 LGEWEKRAPMGFYGTR 190 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.2 bits (40), Expect = 8.1 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = -2 Query: 354 YWPAAKSMPKIXYYNTFTYRRPTRVLY 274 YWP K++ ++ Y R R Y Sbjct: 143 YWPRGKNLGGTTLHHGMAYHRGHRKDY 169 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,889 Number of Sequences: 438 Number of extensions: 2071 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -