BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0295 (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 5.8 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 7.7 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 7.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 Query: 371 SLRNDLLIEPKH 336 S ND +I+PKH Sbjct: 582 SFENDFIIQPKH 593 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 110 KGKFTNEQSLKKKRIFLNASHLHYVTCSPGDPRVL 6 +GK ++S+ KK + HYV G+ R L Sbjct: 549 RGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRWL 583 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 110 KGKFTNEQSLKKKRIFLNASHLHYVTCSPGDPRVL 6 +GK ++S+ KK + HYV G+ R L Sbjct: 782 RGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRWL 816 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 110 KGKFTNEQSLKKKRIFLNASHLHYVTCSPGDPRVL 6 +GK ++S+ KK + HYV G+ R L Sbjct: 782 RGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDRWL 816 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 416 YVLFHNRLHNISLSTV 463 Y L H L N+SLS V Sbjct: 445 YTLLHLNLDNVSLSQV 460 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 110 KGKFTNEQSLKKKRIFLNASHLHYVTCSPGDPR 12 +GK ++S+ KK + HYV G+ R Sbjct: 235 RGKALMDKSVMKKYTTRSTQAKHYVQYDQGEDR 267 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 363 KRFIN*TKTLNSFSIS*PXMFNSS 292 KRF+ T + + ++ P FNSS Sbjct: 164 KRFVVMTSVIMTLALGNPYCFNSS 187 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,071 Number of Sequences: 336 Number of extensions: 2024 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -