BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0291 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 25 0.59 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.5 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 21 7.2 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 24.6 bits (51), Expect = 0.59 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 180 GHRWRDDGRQEIVRSKRQSEVLIAKAVRLVSQDEWQQR 67 GH W+ D +E VR++ Q L A + D+ ++R Sbjct: 117 GHEWQADVSEEAVRARMQD--LTEGAKNMTINDDLEKR 152 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 2.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 57 SKNVSAAIHPGIPTEPPSRSGLRTGAYSGRSP 152 S NV AA HP + P + + S +SP Sbjct: 21 SMNVKAAEHPSLRGTPLAMLAAQCNKLSNKSP 52 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 133 APVRSPDREGGSVGIPG*MA 74 AP++ P REG PG +A Sbjct: 436 APIKGPGREGFYTQNPGFLA 455 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 240 GGTDVSIGHRHLL 202 GG VS HRHLL Sbjct: 325 GGALVSAKHRHLL 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,442 Number of Sequences: 336 Number of extensions: 2137 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -