BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0258 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44018| Best HMM Match : HMA (HMM E-Value=2.7e-06) 51 1e-06 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 45 7e-05 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 44 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 44 2e-04 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 44 2e-04 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 43 3e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 43 3e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 3e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 43 3e-04 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 42 4e-04 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 42 5e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 42 5e-04 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 42 5e-04 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 42 5e-04 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 42 7e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 42 7e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 42 7e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 42 7e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 42 7e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 42 7e-04 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 42 7e-04 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 42 7e-04 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 42 7e-04 SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) 42 7e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 7e-04 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 42 7e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 42 7e-04 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 42 7e-04 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 41 9e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 41 9e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 41 9e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 41 9e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 41 9e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 41 9e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 41 9e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 41 9e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 41 9e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 41 9e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 41 9e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 41 9e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 41 9e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 41 9e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 9e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 41 9e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 41 9e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 41 9e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 41 9e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 41 9e-04 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 41 9e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 41 9e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 41 9e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 41 9e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 41 9e-04 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 41 9e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 41 9e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 41 9e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 41 9e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 41 9e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 41 9e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 41 9e-04 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 41 9e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 41 9e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 41 9e-04 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 41 9e-04 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 41 9e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 >SB_44018| Best HMM Match : HMA (HMM E-Value=2.7e-06) Length = 60 Score = 50.8 bits (116), Expect = 1e-06 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = +3 Query: 333 SGAVERVLNRLKGQGVXDISISLPXQKVSXKSTLSADDLLEIIKKTGKKTTYVG 494 SGAVERVL ++ V +I I L ++V STLS+D+LL IKK GK+ +Y+G Sbjct: 7 SGAVERVLKKVPD--VANIEIDLEMKRVFVTSTLSSDELLATIKKAGKEASYIG 58 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 46.4 bits (105), Expect = 2e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -1 Query: 88 TDKXLITXMPNSCSPGDPLVLERPPP 11 T++ IT + NSCSPGDPLVLERPPP Sbjct: 2 TEEFRITAVSNSCSPGDPLVLERPPP 27 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/49 (44%), Positives = 26/49 (53%) Frame = -1 Query: 157 CSGGIFL*SLADVYSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 C G I + + N L +I + NSCSPGDPLVLERPPP Sbjct: 4 CQGEIKVGFTCALPQNRLDLTFTLGSVIIASLSNSCSPGDPLVLERPPP 52 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 44.8 bits (101), Expect = 7e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 ++T + NSCSPGDPLVLERPPP Sbjct: 511 VVTFLSNSCSPGDPLVLERPPP 532 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T + T + T NSCSPGDPLVLERPPP Sbjct: 2 TNNDTAPLMFTDPSNSCSPGDPLVLERPPP 31 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 44.8 bits (101), Expect = 7e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+T NSCSPGDPLVLERPPP Sbjct: 11 LVTASSNSCSPGDPLVLERPPP 32 >SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/35 (57%), Positives = 23/35 (65%) Frame = -1 Query: 115 SNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++ S T K I NSCSPGDPLVLERPPP Sbjct: 4 TSSFSNNHTTWKYAIDIASNSCSPGDPLVLERPPP 38 >SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 ++T + NSCSPGDPLVLERPPP Sbjct: 34 VLTGLSNSCSPGDPLVLERPPP 55 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = -1 Query: 97 ESXTDKXLITXMPNSCSPGDPLVLERPPP 11 E +D+ I NSCSPGDPLVLERPPP Sbjct: 3 EQQSDRPHIHRASNSCSPGDPLVLERPPP 31 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 9e-05 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 106 LSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +S E ++T + NSCSPGDPLVLERPPP Sbjct: 6 VSPEMPYGLIVLTVVSNSCSPGDPLVLERPPP 37 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -1 Query: 106 LSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 L+ + D ++ NSCSPGDPLVLERPPP Sbjct: 10 LNQSTRGDSPIVEKRSNSCSPGDPLVLERPPP 41 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.4 bits (100), Expect = 9e-05 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -1 Query: 118 YSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL + + + + + NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANIAPRFPLFLISNSCSPGDPLVLERPPP 39 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -1 Query: 94 SXTDKXLITXMPNSCSPGDPLVLERPPP 11 S T +I + NSCSPGDPLVLERPPP Sbjct: 42 SKTAGDVIAFISNSCSPGDPLVLERPPP 69 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/26 (69%), Positives = 20/26 (76%) Frame = -1 Query: 88 TDKXLITXMPNSCSPGDPLVLERPPP 11 T +I + NSCSPGDPLVLERPPP Sbjct: 2 TSSLVIRYISNSCSPGDPLVLERPPP 27 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T++ +I NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIIVYTSNSCSPGDPLVLERPPP 34 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 IT NSCSPGDPLVLERPPP Sbjct: 6 ITTTSNSCSPGDPLVLERPPP 26 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +I+ + NSCSPGDPLVLERPPP Sbjct: 7 VISELSNSCSPGDPLVLERPPP 28 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 ++T NSCSPGDPLVLERPPP Sbjct: 1 MVTSPSNSCSPGDPLVLERPPP 22 >SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -1 Query: 97 ESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +S T+ + NSCSPGDPLVLERPPP Sbjct: 52 KSYTEDDYLDWTSNSCSPGDPLVLERPPP 80 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 IT NSCSPGDPLVLERPPP Sbjct: 35 ITSTSNSCSPGDPLVLERPPP 55 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 LI + NSCSPGDPLVLERPPP Sbjct: 8 LIPMVSNSCSPGDPLVLERPPP 29 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/47 (51%), Positives = 28/47 (59%), Gaps = 3/47 (6%) Frame = -1 Query: 142 FL*SLADVYSNTLSTE---SXTDKXLITXMPNSCSPGDPLVLERPPP 11 FL +D YS++ + S L T NSCSPGDPLVLERPPP Sbjct: 6 FLSVYSDFYSSSSLQDIHWSYDTISLATKTSNSCSPGDPLVLERPPP 52 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 D + + + NSCSPGDPLVLERPPP Sbjct: 7 DSNMCSFVSNSCSPGDPLVLERPPP 31 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 106 LSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 L +E T ++ + NSCSPGDPLVLERPPP Sbjct: 3 LFSEFTTWLKFVSKVSNSCSPGDPLVLERPPP 34 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T++ ++ + NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIVFLISNSCSPGDPLVLERPPP 34 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K ++ + NSCSPGDPLVLERPPP Sbjct: 23 KLVLQGLSNSCSPGDPLVLERPPP 46 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -1 Query: 121 VYS-NTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +YS N S++ + L NSCSPGDPLVLERPPP Sbjct: 61 LYSGNPPSSQVFSQSPLSRFTSNSCSPGDPLVLERPPP 98 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T + NSCSPGDPLVLERPPP Sbjct: 61 TLLSNSCSPGDPLVLERPPP 80 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 DK L NSCSPGDPLVLERPPP Sbjct: 56 DKRLGHARSNSCSPGDPLVLERPPP 80 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +I + NSCSPGDPLVLERPPP Sbjct: 4 MIVVVSNSCSPGDPLVLERPPP 25 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T + NSCSPGDPLVLERPPP Sbjct: 1 TLLSNSCSPGDPLVLERPPP 20 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T + NSCSPGDPLVLERPPP Sbjct: 18 TVLSNSCSPGDPLVLERPPP 37 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 +T NSCSPGDPLVLERPPP Sbjct: 2 VTIASNSCSPGDPLVLERPPP 22 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/27 (70%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = -1 Query: 88 TDKXLITXMP-NSCSPGDPLVLERPPP 11 TD + +P NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIPSNSCSPGDPLVLERPPP 31 >SB_29965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -1 Query: 118 YSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL + + T NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANIVRLYYYTFGSNSCSPGDPLVLERPPP 39 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = -1 Query: 115 SNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +N L + D + NSCSPGDPLVLERPPP Sbjct: 72 ANKLMRKLAVDASNLLLTSNSCSPGDPLVLERPPP 106 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = -1 Query: 118 YSNTL-STESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL S ++ + + NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANIFSEPKRVNAVSNSCSPGDPLVLERPPP 40 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 +T NSCSPGDPLVLERPPP Sbjct: 47 VTHTSNSCSPGDPLVLERPPP 67 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 121 VYSNTLSTESXT-DKXLITXMPNSCSPGDPLVLERPPP 11 +YS+ L+ S +K + NSCSPGDPLVLERPPP Sbjct: 6 IYSHRLTNYSNCLNKCHNIVISNSCSPGDPLVLERPPP 43 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+ + NSCSPGDPLVLERPPP Sbjct: 42 LVIGISNSCSPGDPLVLERPPP 63 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/27 (70%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = -1 Query: 88 TDKXLITXMP-NSCSPGDPLVLERPPP 11 TD + +P NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIPSNSCSPGDPLVLERPPP 31 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -1 Query: 103 STESXTDKXLITXMPNSCSPGDPLVLERPPP 11 S E + + + NSCSPGDPLVLERPPP Sbjct: 248 SVEFLRENPVTEYISNSCSPGDPLVLERPPP 278 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = -1 Query: 121 VYSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 ++ N + S + + NSCSPGDPLVLERPPP Sbjct: 195 IHKNLMKIISSPEICKTVNVSNSCSPGDPLVLERPPP 231 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 LI NSCSPGDPLVLERPPP Sbjct: 15 LIKITSNSCSPGDPLVLERPPP 36 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T + NSCSPGDPLVLERPPP Sbjct: 76 TIVSNSCSPGDPLVLERPPP 95 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+ NSCSPGDPLVLERPPP Sbjct: 795 LVAISSNSCSPGDPLVLERPPP 816 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/37 (51%), Positives = 27/37 (72%) Frame = -1 Query: 121 VYSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 V+ + ++ E+ + K + + NSCSPGDPLVLERPPP Sbjct: 14 VFGHKIAIENSSLKPTFS-ISNSCSPGDPLVLERPPP 49 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 21 INNLSNSCSPGDPLVLERPPP 41 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -1 Query: 115 SNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 SNT + E L+ NSCSPGDPLVLERPPP Sbjct: 211 SNTPAAEQRNYTQLLESS-NSCSPGDPLVLERPPP 244 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 +T NSCSPGDPLVLERPPP Sbjct: 18 LTFTSNSCSPGDPLVLERPPP 38 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 32 ISLISNSCSPGDPLVLERPPP 52 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T + NSCSPGDPLVLERPPP Sbjct: 3 TIISNSCSPGDPLVLERPPP 22 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 31 ISLISNSCSPGDPLVLERPPP 51 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ + NSCSPGDPLVLERPPP Sbjct: 29 ISLISNSCSPGDPLVLERPPP 49 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K L NSCSPGDPLVLERPPP Sbjct: 14 KALTNKSSNSCSPGDPLVLERPPP 37 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 88 TDKXLITXMPNSCSPGDPLVLERPPP 11 T+ + + NSCSPGDPLVLERPPP Sbjct: 22 TEDYKVYPVSNSCSPGDPLVLERPPP 47 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 ++ + NSCSPGDPLVLERPPP Sbjct: 12 IVQQISNSCSPGDPLVLERPPP 33 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 D+ + NSCSPGDPLVLERPPP Sbjct: 55 DEPTAKKLSNSCSPGDPLVLERPPP 79 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/22 (86%), Positives = 19/22 (86%), Gaps = 1/22 (4%) Frame = -1 Query: 73 ITXMP-NSCSPGDPLVLERPPP 11 IT P NSCSPGDPLVLERPPP Sbjct: 13 ITWRPSNSCSPGDPLVLERPPP 34 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 74 DNXNAEFLQPGGSTSSRAAATGGG 3 D + EFLQPGGSTSSRAAAT GG Sbjct: 29 DKLDIEFLQPGGSTSSRAAATAGG 52 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = -1 Query: 118 YSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL + + T NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANITRVTNSRPRSNSCSPGDPLVLERPPP 39 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 ++T NSCSPGDPLVLERPPP Sbjct: 7 VLTVGSNSCSPGDPLVLERPPP 28 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K LIT NSCSPGDPLVLERPPP Sbjct: 17 KLLITS--NSCSPGDPLVLERPPP 38 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+ NSCSPGDPLVLERPPP Sbjct: 17 LLAPTSNSCSPGDPLVLERPPP 38 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = -1 Query: 118 YSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL + + + NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANIRRPTIQARKSNSCSPGDPLVLERPPP 39 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L + NSCSPGDPLVLERPPP Sbjct: 7 LCVFLSNSCSPGDPLVLERPPP 28 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 13 IVHISNSCSPGDPLVLERPPP 33 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -1 Query: 112 NTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 NT + T + NSCSPGDPLVLERPPP Sbjct: 19 NTTFSTLKTKNAPLKLSSNSCSPGDPLVLERPPP 52 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 33 TAQSNSCSPGDPLVLERPPP 52 >SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -1 Query: 88 TDKXLITXMPNSCSPGDPLVLERPPP 11 T K +I + NSCSPGDPLVLERPPP Sbjct: 28 TQKPVI-FLSNSCSPGDPLVLERPPP 52 >SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 3 ILFLSNSCSPGDPLVLERPPP 23 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 52 IPLLSNSCSPGDPLVLERPPP 72 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 16 IAFVSNSCSPGDPLVLERPPP 36 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ + NSCSPGDPLVLERPPP Sbjct: 31 VSLISNSCSPGDPLVLERPPP 51 >SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +I + NSCSPGDPLVLERPPP Sbjct: 20 VIHVLSNSCSPGDPLVLERPPP 41 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 3 IVIISNSCSPGDPLVLERPPP 23 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T+S T+ T NSCSPGDPLVLERPPP Sbjct: 38 TKSTTES---TITSNSCSPGDPLVLERPPP 64 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 42.3 bits (95), Expect = 4e-04 Identities = 24/41 (58%), Positives = 25/41 (60%) Frame = -1 Query: 133 SLADVYSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 SL Y S T K LI+ NSCSPGDPLVLERPPP Sbjct: 21 SLYQQYRIGKSENLWTFKHLIS---NSCSPGDPLVLERPPP 58 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 34 IPALSNSCSPGDPLVLERPPP 54 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +I+ NSCSPGDPLVLERPPP Sbjct: 6 VISKTSNSCSPGDPLVLERPPP 27 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 +T NSCSPGDPLVLERPPP Sbjct: 1 MTLASNSCSPGDPLVLERPPP 21 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+ NSCSPGDPLVLERPPP Sbjct: 10 LVIKTSNSCSPGDPLVLERPPP 31 >SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K + + NSCSPGDPLVLERPPP Sbjct: 6 KQCLLEISNSCSPGDPLVLERPPP 29 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 7 INSVSNSCSPGDPLVLERPPP 27 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K + + NSCSPGDPLVLERPPP Sbjct: 28 KQRMEYLSNSCSPGDPLVLERPPP 51 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L+ NSCSPGDPLVLERPPP Sbjct: 22 LVPRPSNSCSPGDPLVLERPPP 43 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 10 TISSNSCSPGDPLVLERPPP 29 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 61 VQPLSNSCSPGDPLVLERPPP 81 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 ++ + NSCSPGDPLVLERPPP Sbjct: 16 ERPSVASQSNSCSPGDPLVLERPPP 40 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ NSCSPGDPLVLERPPP Sbjct: 31 ISKTSNSCSPGDPLVLERPPP 51 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = -1 Query: 88 TDKXLITXMPNSCSPGDPLVLERPPP 11 TD NSCSPGDPLVLERPPP Sbjct: 8 TDALPTALTSNSCSPGDPLVLERPPP 33 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 14 TPTSNSCSPGDPLVLERPPP 33 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K + NSCSPGDPLVLERPPP Sbjct: 2 KHFTDTLSNSCSPGDPLVLERPPP 25 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 + + + NSCSPGDPLVLERPPP Sbjct: 34 REFVLRVSNSCSPGDPLVLERPPP 57 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 7 IRGISNSCSPGDPLVLERPPP 27 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T++ + + NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIDIPLSNSCSPGDPLVLERPPP 34 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 49 VNDISNSCSPGDPLVLERPPP 69 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +++ NSCSPGDPLVLERPPP Sbjct: 554 ILSDRSNSCSPGDPLVLERPPP 575 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 13 TLRSNSCSPGDPLVLERPPP 32 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 31 IGVLSNSCSPGDPLVLERPPP 51 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/21 (85%), Positives = 19/21 (90%), Gaps = 1/21 (4%) Frame = -1 Query: 70 TXMP-NSCSPGDPLVLERPPP 11 T +P NSCSPGDPLVLERPPP Sbjct: 4 TGLPSNSCSPGDPLVLERPPP 24 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 D+ + NSCSPGDPLVLERPPP Sbjct: 16 DRDTDRHLSNSCSPGDPLVLERPPP 40 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 5 TLASNSCSPGDPLVLERPPP 24 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K + NSCSPGDPLVLERPPP Sbjct: 41 KPIFKPTSNSCSPGDPLVLERPPP 64 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 41.9 bits (94), Expect = 5e-04 Identities = 22/41 (53%), Positives = 23/41 (56%) Frame = -1 Query: 133 SLADVYSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 S D TLS + I NSCSPGDPLVLERPPP Sbjct: 41 SNVDKLKETLS--KLPNNLFIITTSNSCSPGDPLVLERPPP 79 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -1 Query: 109 TLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T E + L + NSCSPGDPLVLERPPP Sbjct: 3 TRKREGGSFAGLWASISNSCSPGDPLVLERPPP 35 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 53 VRALSNSCSPGDPLVLERPPP 73 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 56 IPPVSNSCSPGDPLVLERPPP 76 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 49 TASSNSCSPGDPLVLERPPP 68 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.9 bits (94), Expect = 5e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 44 VQSLSNSCSPGDPLVLERPPP 64 >SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 3 TFTSNSCSPGDPLVLERPPP 22 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/29 (68%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -1 Query: 94 SXTDKXLITXMP-NSCSPGDPLVLERPPP 11 S + K I P NSCSPGDPLVLERPPP Sbjct: 64 SVSKKDWIVDNPSNSCSPGDPLVLERPPP 92 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 82 KXLITXMPNSCSPGDPLVLERPPP 11 K + + NSCSPGDPLVLERPPP Sbjct: 110 KRRLLGISNSCSPGDPLVLERPPP 133 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 D+ + + NSCSPGDPLVLERPPP Sbjct: 7 DENVRCDISNSCSPGDPLVLERPPP 31 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 22 TISSNSCSPGDPLVLERPPP 41 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 31 ICTVSNSCSPGDPLVLERPPP 51 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 D I NSCSPGDPLVLERPPP Sbjct: 6 DLIYILDTSNSCSPGDPLVLERPPP 30 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 12 TKTSNSCSPGDPLVLERPPP 31 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/30 (56%), Positives = 20/30 (66%) Frame = -1 Query: 100 TESXTDKXLITXMPNSCSPGDPLVLERPPP 11 T++ + NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANITNISSNSCSPGDPLVLERPPP 34 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I+ NSCSPGDPLVLERPPP Sbjct: 13 ISQTSNSCSPGDPLVLERPPP 33 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 L + + NSCSPGDPLVLERPPP Sbjct: 344 LHSIVSNSCSPGDPLVLERPPP 365 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/32 (62%), Positives = 23/32 (71%) Frame = -1 Query: 106 LSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 L + T+K L + NSCSPGDPLVLERPPP Sbjct: 89 LISHRQTNKSL--KISNSCSPGDPLVLERPPP 118 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ NSCSPGDPLVLERPPP Sbjct: 3 LSTQSNSCSPGDPLVLERPPP 23 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 7 VLFVSNSCSPGDPLVLERPPP 27 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 162 LSNSCSPGDPLVLERPPP 179 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 61 TNPSNSCSPGDPLVLERPPP 80 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 24 LSNSCSPGDPLVLERPPP 41 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 93 LSNSCSPGDPLVLERPPP 110 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.5 bits (93), Expect = 7e-04 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = -1 Query: 118 YSNTL-STESXTDKXLITXMP--NSCSPGDPLVLERPPP 11 +++TL S T I P NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANILTYSFCIVEFPGSNSCSPGDPLVLERPPP 42 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 14 LSNSCSPGDPLVLERPPP 31 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 23 LSNSCSPGDPLVLERPPP 40 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 13 LSNSCSPGDPLVLERPPP 30 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 16 LSNSCSPGDPLVLERPPP 33 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 15 LSNSCSPGDPLVLERPPP 32 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 50 LSNSCSPGDPLVLERPPP 67 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 7 LSNSCSPGDPLVLERPPP 24 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 56 LSNSCSPGDPLVLERPPP 73 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -1 Query: 97 ESXTDKXLITXMPNSCSPGDPLVLERPPP 11 ES T+ NSCSPGDPLVLERPPP Sbjct: 123 ESQTNLRARIVGSNSCSPGDPLVLERPPP 151 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ NSCSPGDPLVLERPPP Sbjct: 8 LSYQSNSCSPGDPLVLERPPP 28 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I NSCSPGDPLVLERPPP Sbjct: 21 IIRQSNSCSPGDPLVLERPPP 41 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 4 LSNSCSPGDPLVLERPPP 21 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/21 (80%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 I + NSCSPGDPLVLERPPP Sbjct: 6 IYLISNSCSPGDPLVLERPPP 26 >SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 78 LSNSCSPGDPLVLERPPP 95 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = -1 Query: 118 YSNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL + + + NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANIQAIVQVIYPSNSCSPGDPLVLERPPP 39 >SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 3 LSNSCSPGDPLVLERPPP 20 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 12 LSNSCSPGDPLVLERPPP 29 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 11 LSNSCSPGDPLVLERPPP 28 >SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 4 LSNSCSPGDPLVLERPPP 21 >SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 6 LSNSCSPGDPLVLERPPP 23 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 41.5 bits (93), Expect = 7e-04 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = -1 Query: 154 SGGIFL*SLADVYSNTLSTESX----TDKXLITXMP-NSCSPGDPLVLERPPP 11 + G FL + D + ST S + L++ NSCSPGDPLVLERPPP Sbjct: 82 ASGSFLQIIGDTFGLPKSTVSRCVSDVTRALVSKAESNSCSPGDPLVLERPPP 134 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = -1 Query: 115 SNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 SN+LS+ T NSCSPGDPLVLERPPP Sbjct: 7 SNSLSSAKNTIGSY-EVTSNSCSPGDPLVLERPPP 40 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 7 LSNSCSPGDPLVLERPPP 24 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = -1 Query: 106 LSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 L+T + T + + NSCSPGDPLVLERPPP Sbjct: 12 LTTNAAT-RVRFPLISNSCSPGDPLVLERPPP 42 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 7 LSNSCSPGDPLVLERPPP 24 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/29 (65%), Positives = 21/29 (72%), Gaps = 3/29 (10%) Frame = -1 Query: 88 TDKXLITXMP---NSCSPGDPLVLERPPP 11 TD + +P NSCSPGDPLVLERPPP Sbjct: 5 TDTLISANIPKRSNSCSPGDPLVLERPPP 33 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 66 LSNSCSPGDPLVLERPPP 83 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 612 LSNSCSPGDPLVLERPPP 629 >SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 61 LSNSCSPGDPLVLERPPP 78 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 46 LSNSCSPGDPLVLERPPP 63 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 44 TVPSNSCSPGDPLVLERPPP 63 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 14 LSNSCSPGDPLVLERPPP 31 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 2 VLGISNSCSPGDPLVLERPPP 22 >SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 5 LSNSCSPGDPLVLERPPP 22 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 23 LSNSCSPGDPLVLERPPP 40 >SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 13 LSNSCSPGDPLVLERPPP 30 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 85 LSNSCSPGDPLVLERPPP 102 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/33 (57%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -1 Query: 106 LSTESXTDKXLITXM-PNSCSPGDPLVLERPPP 11 +S ++K +T NSCSPGDPLVLERPPP Sbjct: 45 ISKTIMSEKGTVTHRRSNSCSPGDPLVLERPPP 77 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 15 LSNSCSPGDPLVLERPPP 32 >SB_30140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 10 LSNSCSPGDPLVLERPPP 27 >SB_29960| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_29661| Best HMM Match : DUF872 (HMM E-Value=8.6) Length = 345 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 221 LSNSCSPGDPLVLERPPP 238 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = -1 Query: 121 VYSNTLSTESXTDKXLITX--MPNSCSPGDPLVLERPPP 11 + +N + ++ + ++T + NSCSPGDPLVLERPPP Sbjct: 9 ISANIIIEKANDNARIVTKFGVSNSCSPGDPLVLERPPP 47 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ NSCSPGDPLVLERPPP Sbjct: 4 VSLSSNSCSPGDPLVLERPPP 24 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ NSCSPGDPLVLERPPP Sbjct: 10 VSYTSNSCSPGDPLVLERPPP 30 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 171 LSNSCSPGDPLVLERPPP 188 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = -1 Query: 70 TXMPNSCSPGDPLVLERPPP 11 T NSCSPGDPLVLERPPP Sbjct: 5 TTPSNSCSPGDPLVLERPPP 24 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.5 bits (93), Expect = 7e-04 Identities = 21/37 (56%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 118 YSNTL-STESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +++TL S T L+ NSCSPGDPLVLERPPP Sbjct: 4 FTDTLISANINTQSKLVAS--NSCSPGDPLVLERPPP 38 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 19 LSNSCSPGDPLVLERPPP 36 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/23 (78%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = -1 Query: 76 LITXMP-NSCSPGDPLVLERPPP 11 L+ P NSCSPGDPLVLERPPP Sbjct: 40 LVANKPSNSCSPGDPLVLERPPP 62 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = -1 Query: 103 STESXTDKXLITXMPNSCSPGDPLVLERPPP 11 S S T +I+ NSCSPGDPLVLERPPP Sbjct: 8 SASSTTSAPVIS---NSCSPGDPLVLERPPP 35 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/33 (57%), Positives = 20/33 (60%) Frame = -1 Query: 109 TLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +L S I NSCSPGDPLVLERPPP Sbjct: 73 SLVIRSIGSALFIIQTSNSCSPGDPLVLERPPP 105 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 13 VAAALELVDPPGCRNS 60 VAAALELVDPPGCRNS Sbjct: 9 VAAALELVDPPGCRNS 24 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 + + NSCSPGDPLVLERPPP Sbjct: 87 VMTISNSCSPGDPLVLERPPP 107 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 105 LSNSCSPGDPLVLERPPP 122 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 2 LSNSCSPGDPLVLERPPP 19 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 63 LSNSCSPGDPLVLERPPP 80 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 8 LSNSCSPGDPLVLERPPP 25 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 13 LSNSCSPGDPLVLERPPP 30 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 36 LSNSCSPGDPLVLERPPP 53 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 33 LSNSCSPGDPLVLERPPP 50 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = -1 Query: 85 DKXLITXMPNSCSPGDPLVLERPPP 11 +K + NSCSPGDPLVLERPPP Sbjct: 44 NKRRVYVTSNSCSPGDPLVLERPPP 68 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 14 LSNSCSPGDPLVLERPPP 31 >SB_4628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 64 MPNSCSPGDPLVLERPPP 11 + NSCSPGDPLVLERPPP Sbjct: 18 LSNSCSPGDPLVLERPPP 35 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 73 ITXMPNSCSPGDPLVLERPPP 11 ++ NSCSPGDPLVLERPPP Sbjct: 17 VSITSNSCSPGDPLVLERPPP 37 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/35 (54%), Positives = 23/35 (65%) Frame = -1 Query: 115 SNTLSTESXTDKXLITXMPNSCSPGDPLVLERPPP 11 +N ++TE+ NSCSPGDPLVLERPPP Sbjct: 5 ANAINTETKPVGAHNMAGSNSCSPGDPLVLERPPP 39 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.5 bits (93), Expect = 7e-04 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -1 Query: 76 LITXMPNSCSPGDPLVLERPPP 11 +I NSCSPGDPLVLERPPP Sbjct: 10 IIPKPSNSCSPGDPLVLERPPP 31 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 13 NSCSPGDPLVLERPPP 28 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 27 NSCSPGDPLVLERPPP 42 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 185 NSCSPGDPLVLERPPP 200 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 80 NSCSPGDPLVLERPPP 95 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 16 NSCSPGDPLVLERPPP 31 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 7 NSCSPGDPLVLERPPP 22 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 28 NSCSPGDPLVLERPPP 43 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 8 NSCSPGDPLVLERPPP 23 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 383 NSCSPGDPLVLERPPP 398 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 25 NSCSPGDPLVLERPPP 40 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 15 NSCSPGDPLVLERPPP 30 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 32 NSCSPGDPLVLERPPP 47 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 3 NSCSPGDPLVLERPPP 18 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 9 NSCSPGDPLVLERPPP 24 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 23 NSCSPGDPLVLERPPP 38 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 4 NSCSPGDPLVLERPPP 19 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 41.1 bits (92), Expect = 9e-04 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 74 DNXNAEFLQPGGSTSSRAAATGGG 3 D + EFLQPGGSTSSRAAAT GG Sbjct: 16 DKLDIEFLQPGGSTSSRAAATVGG 39 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 55 NSCSPGDPLVLERPPP 70 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 26 NSCSPGDPLVLERPPP 41 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 20 NSCSPGDPLVLERPPP 35 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 14 NSCSPGDPLVLERPPP 29 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 21 NSCSPGDPLVLERPPP 36 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 22 NSCSPGDPLVLERPPP 37 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 36 NSCSPGDPLVLERPPP 51 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 19 NSCSPGDPLVLERPPP 34 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 18 NSCSPGDPLVLERPPP 33 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 17 NSCSPGDPLVLERPPP 32 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 6 NSCSPGDPLVLERPPP 21 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 5 NSCSPGDPLVLERPPP 20 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 12 NSCSPGDPLVLERPPP 27 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 49 NSCSPGDPLVLERPPP 64 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -1 Query: 58 NSCSPGDPLVLERPPP 11 NSCSPGDPLVLERPPP Sbjct: 114 NSCSPGDPLVLERPPP 129 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,588,381 Number of Sequences: 59808 Number of extensions: 343734 Number of successful extensions: 2775 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2774 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -