BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0258 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles ... 25 2.4 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.5 >U50479-1|AAA93478.1| 151|Anopheles gambiae protein ( Anopheles gambiae putativeribosomal protein S13 mRNA, complete cds. ). Length = 151 Score = 25.0 bits (52), Expect = 2.4 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 354 LNRLKGQGVXDISISLPXQK-VSXKSTLSADDLLEIIKKTGKK 479 + R+ G +LP ++ V LSA+D+ E IKK GKK Sbjct: 1 MGRMHAPGKGISKSALPYRRSVPSWLKLSAEDVKEQIKKLGKK 43 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 441 DDLLEIIKKTGKKTTYVGAQXNYWWXLIPQNLRPFGCSK 557 D L ++ K G T ++ +W LI + L+P S+ Sbjct: 869 DWLYDVDLKNGDTETISASEEQFWIELIEKYLKPLDLSE 907 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,277 Number of Sequences: 2352 Number of extensions: 11649 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -