Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0253
         (663 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q30Q62 Cluster: Putative uncharacterized protein; n=1; ...    33   8.1  

>UniRef50_Q30Q62 Cluster: Putative uncharacterized protein; n=1;
           Thiomicrospira denitrificans ATCC 33889|Rep: Putative
           uncharacterized protein - Thiomicrospira denitrificans
           (strain ATCC 33889 / DSM 1351)
          Length = 378

 Score = 32.7 bits (71), Expect = 8.1
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 2/63 (3%)
 Frame = +3

Query: 141 LNVTTFINPCKEPVQENDP*MNTVHMKYLSVCVCLFNIIQFKNV--ITLKKEKKKHPCRI 314
           L +TT+    +E + EN+P     H KY  +C+    +  F+    +       KH CR+
Sbjct: 87  LILTTYSGYIQENIYENNPATFFTHQKYCPICLREDKVPYFRKKWRVVFYNICHKHQCRL 146

Query: 315 FRH 323
           + H
Sbjct: 147 YEH 149


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 525,098,866
Number of Sequences: 1657284
Number of extensions: 8485670
Number of successful extensions: 18064
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17640
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18062
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 50413227838
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)