BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0235 (657 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC004493-2|AAC08453.1| 1791|Homo sapiens KIAA0324 protein. 33 1.2 AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein pro... 33 1.2 AB016091-1|BAA83717.1| 1275|Homo sapiens RNA binding protein pro... 33 1.2 AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. 33 1.2 >AC004493-2|AAC08453.1| 1791|Homo sapiens KIAA0324 protein. Length = 1791 Score = 32.7 bits (71), Expect = 1.2 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = -2 Query: 341 SRTIVPHTRTRYPQMIQKKLTHQRSNISAA*TRRATLAGPSLVESYKTKRDSSE*TMRQC 162 SR+ P TR R + + + TRR + + S + +++ +S T R+ Sbjct: 967 SRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRS 1026 Query: 161 TKFTSHSLEILSKWRSARTTRRSQQNDAPPHIRR 60 TS S+ R++ TRR ++ PP IRR Sbjct: 1027 RSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRR 1060 >AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein protein. Length = 2752 Score = 32.7 bits (71), Expect = 1.2 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = -2 Query: 341 SRTIVPHTRTRYPQMIQKKLTHQRSNISAA*TRRATLAGPSLVESYKTKRDSSE*TMRQC 162 SR+ P TR R + + + TRR + + S + +++ +S T R+ Sbjct: 1935 SRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRS 1994 Query: 161 TKFTSHSLEILSKWRSARTTRRSQQNDAPPHIRR 60 TS S+ R++ TRR ++ PP IRR Sbjct: 1995 RSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRR 2028 >AB016091-1|BAA83717.1| 1275|Homo sapiens RNA binding protein protein. Length = 1275 Score = 32.7 bits (71), Expect = 1.2 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = -2 Query: 341 SRTIVPHTRTRYPQMIQKKLTHQRSNISAA*TRRATLAGPSLVESYKTKRDSSE*TMRQC 162 SR+ P TR R + + + TRR + + S + +++ +S T R+ Sbjct: 458 SRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRS 517 Query: 161 TKFTSHSLEILSKWRSARTTRRSQQNDAPPHIRR 60 TS S+ R++ TRR ++ PP IRR Sbjct: 518 RSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRR 551 >AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. Length = 2800 Score = 32.7 bits (71), Expect = 1.2 Identities = 25/94 (26%), Positives = 42/94 (44%) Frame = -2 Query: 341 SRTIVPHTRTRYPQMIQKKLTHQRSNISAA*TRRATLAGPSLVESYKTKRDSSE*TMRQC 162 SR+ P TR R + + + TRR + + S + +++ +S T R+ Sbjct: 1983 SRSRTPTTRRRSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPITRRRSRSRTSPVTRRRS 2042 Query: 161 TKFTSHSLEILSKWRSARTTRRSQQNDAPPHIRR 60 TS S+ R++ TRR ++ PP IRR Sbjct: 2043 RSRTSPVTRRRSRSRTSPVTRRRSRSRTPPAIRR 2076 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,708,510 Number of Sequences: 237096 Number of extensions: 1412642 Number of successful extensions: 6188 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6188 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -