BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0235 (657 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF160975-1|AAF05113.1| 784|Drosophila melanogaster Liquid facet... 28 9.7 AE014296-1284|AAN12042.2| 784|Drosophila melanogaster CG8532-PC... 28 9.7 >AF160975-1|AAF05113.1| 784|Drosophila melanogaster Liquid facets protein. Length = 784 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 360 SNTSRVQPN---YRTAYPNSISSDDSKKTNASEIKHLGCMNTPRHACGSFP 217 S TS+ QPN Y AY +S S++ K+N + N+ H+C + P Sbjct: 617 STTSQPQPNLQVYNNAYQSSSSTNILGKSNIPTNMNSSTSNSTIHSCYASP 667 >AE014296-1284|AAN12042.2| 784|Drosophila melanogaster CG8532-PC, isoform C protein. Length = 784 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -1 Query: 360 SNTSRVQPN---YRTAYPNSISSDDSKKTNASEIKHLGCMNTPRHACGSFP 217 S TS+ QPN Y AY +S S++ K+N + N+ H+C + P Sbjct: 617 STTSQPQPNLQVYNNAYQSSSSTNILGKSNIPTNMNSSTSNSTIHSCYASP 667 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,476,666 Number of Sequences: 53049 Number of extensions: 466547 Number of successful extensions: 1142 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1142 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2806815600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -