BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0235 (657 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical ... 29 2.9 AC199240-1|ABO33278.1| 427|Caenorhabditis elegans Hypothetical ... 27 8.9 >AF038605-2|AAB92020.1| 698|Caenorhabditis elegans Hypothetical protein C02B10.5 protein. Length = 698 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = -2 Query: 230 AGPSLVESYKTKRDSSE*TMRQCTK-FTSHSLEILSKWRSARTTRRSQQNDAPPHIRR 60 A PSLV+S K + ++ R T TS ++ S R+ SQ+ +PP +RR Sbjct: 29 ASPSLVKSEVVKEEENDDADRTLTMPSTSQDIQPESSPAHGRSAPSSQEITSPPTVRR 86 >AC199240-1|ABO33278.1| 427|Caenorhabditis elegans Hypothetical protein 2L52.1 protein. Length = 427 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 341 SRTIVPHTRTRYPQMIQKKLTHQRSN 264 S ++VP R +P+ ++K+L+ QR+N Sbjct: 229 SASMVPSKRRNWPKRVKKRLSTQRNN 254 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,124,116 Number of Sequences: 27780 Number of extensions: 242623 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1465835342 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -