BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0235 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.84 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.84 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.5 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 280 RIRDQTSRLHEHAAPRLRVLPSSSLTKLNVIRANK 176 R +Q L ++ APRL L S + ++V+R K Sbjct: 559 RTEEQRIALRKYHAPRLAKLALESTSMIDVVRYGK 593 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 24.6 bits (51), Expect = 0.84 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 280 RIRDQTSRLHEHAAPRLRVLPSSSLTKLNVIRANK 176 R +Q L ++ APRL L S + ++V+R K Sbjct: 597 RTEEQRIALRKYHAPRLAKLALESTSMIDVVRYGK 631 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 336 NYRTAYPNSISSDDSKKTNASEIKHLGCMNT 244 +YRTA+ N S+ + E+K L C NT Sbjct: 1440 HYRTAHGNLDELQLSRHATSHELKGLLCGNT 1470 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 336 NYRTAYPNSISSDDSKKTNASEIKHLGCMNT 244 +YRTA+ N S+ + E+K L C NT Sbjct: 1436 HYRTAHGNLDELQLSRHATSHELKGLLCGNT 1466 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,525 Number of Sequences: 438 Number of extensions: 3257 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -