BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0235 (657 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g13840.1 68415.m01532 PHP domain-containing protein contains ... 28 6.3 >At2g13840.1 68415.m01532 PHP domain-containing protein contains Pfam PF02231: PHP domain N-terminal region and Pfam PF02811: PHP domain C-terminal region; identical to Protein trpH. (Swiss-Prot:O54453) [Salmonella typhimurium] Length = 434 Score = 27.9 bits (59), Expect = 6.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 202 KLNVIRANKQCGSVQNLHHIHSKY*ANGGP 113 +++V RA + G V+NL +KY +GGP Sbjct: 208 RMHVARALLEAGYVENLRQAFTKYLHDGGP 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,057,849 Number of Sequences: 28952 Number of extensions: 217924 Number of successful extensions: 492 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -