BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0215 (666 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0965 + 21915842-21916906 29 4.4 07_01_0497 + 3731842-3732386,3732487-3732808,3733232-3733474 28 7.7 04_04_0751 - 27769616-27769684,27769795-27769917,27769998-277707... 28 7.7 >10_08_0965 + 21915842-21916906 Length = 354 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/52 (28%), Positives = 29/52 (55%) Frame = -2 Query: 593 IQRSSHQLWAFSQGQVWRIPQWEVCSNLKACLRFSVFCGSTQAAFRDEQTIR 438 + ++S + A + + R+P + + S+L A + S C Q+AFRD+ +R Sbjct: 92 VGKASAERAAEMERLISRLPLFTLASSLAALPKSSRDCAVCQSAFRDDDELR 143 >07_01_0497 + 3731842-3732386,3732487-3732808,3733232-3733474 Length = 369 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 458 GRRPECFHKRLRISDMLLNLNRLPTXESAILDLVKMPKVD 577 G RP+ F + L D+++N+N P L L P D Sbjct: 208 GLRPDYFERDLTAGDVIINVNHYPPCPDPSLTLGLPPHCD 247 >04_04_0751 - 27769616-27769684,27769795-27769917,27769998-27770770, 27771407-27771773,27772104-27772217,27772307-27772403, 27772968-27773088,27773168-27773252,27773349-27773498, 27773630-27773746,27773819-27773905,27773981-27774049, 27774125-27774181,27774266-27774349,27774477-27774513, 27774721-27774869,27776053-27776538,27776743-27776886, 27776961-27777509,27778332-27778526,27779226-27779310, 27779570-27779670,27779689-27780360,27781101-27781433, 27781957-27782038,27782258-27782334,27782713-27782817, 27783810-27783944,27784437-27785159,27785882-27786663, 27787480-27789187 Length = 2891 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +2 Query: 89 LADDFSQITAVVTSQCTKNNAEDKVPEVEAALRTFGNCLKGLVD 220 +AD QI+A V + T A + V+ A ++G+C+ L + Sbjct: 1320 MADSNGQISAAVMERLTSAAAAEPYESVKHAFVSYGSCIADLAE 1363 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,699,496 Number of Sequences: 37544 Number of extensions: 343170 Number of successful extensions: 846 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1679486824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -