BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0212 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 1.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 1.9 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 325 VI*TFQGIL*FTKNNINIIVLWDC*LKTKPIT--XYAKINTTL 447 VI T G+ FT+ N N I WD + P T A+ NTT+ Sbjct: 303 VIDTNTGVDYFTQINRNGIACWDTNTELNPNTFILVAENNTTM 345 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,048 Number of Sequences: 438 Number of extensions: 2907 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -