BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0210 (664 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59204| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_42850| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_16626| Best HMM Match : DUF1257 (HMM E-Value=3.6) 39 0.003 SB_56472| Best HMM Match : Transposase_5 (HMM E-Value=1.2) 38 0.007 SB_1045| Best HMM Match : Hormone_3 (HMM E-Value=3.9) 36 0.039 SB_21757| Best HMM Match : Hormone_3 (HMM E-Value=3.9) 36 0.039 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_19248| Best HMM Match : HECT (HMM E-Value=7.2e-10) 31 0.84 SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 30 1.5 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 29 3.4 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 29 4.5 SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) 29 4.5 SB_3378| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_50401| Best HMM Match : Pkinase (HMM E-Value=1.7e-16) 28 5.9 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_30827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 28 7.8 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 28 7.8 SB_41275| Best HMM Match : Lig_chan (HMM E-Value=2.3e-11) 28 7.8 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_10167| Best HMM Match : Trypsin (HMM E-Value=0) 28 7.8 SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) 28 7.8 >SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C+Q Sbjct: 91 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLQ 150 Query: 72 NHGGHFE 52 +GGH E Sbjct: 151 RNGGHLE 157 >SB_59204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 361 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%) Frame = -2 Query: 246 NPLDYKIWQHLEEKACSKPHPN-LESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQN 70 NP++ +W ++E+ P P + SLK+ KA ++ + + P+RLK I+ Sbjct: 199 NPIE-NLWSIIDEETYRDPQPRTMTSLKSRFKKAWRNVSLSTLSELSHSMPQRLKNVIKA 257 Query: 69 HGGHFE*TLV 40 GGH TL+ Sbjct: 258 KGGHANYTLI 267 Score = 37.5 bits (83), Expect = 0.010 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -1 Query: 376 NNRHWVFQQDSAPAHRAKSTQDWLRR 299 N R +F QD APAH AK++QDW ++ Sbjct: 162 NKRSMLFVQDGAPAHTAKASQDWCKK 187 >SB_42850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C+Q Sbjct: 91 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLQ 150 Query: 72 NHG 64 +G Sbjct: 151 RNG 153 >SB_16626| Best HMM Match : DUF1257 (HMM E-Value=3.6) Length = 267 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C+Q Sbjct: 39 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLQ 98 Query: 72 NHG 64 +G Sbjct: 99 RNG 101 >SB_56472| Best HMM Match : Transposase_5 (HMM E-Value=1.2) Length = 615 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/63 (26%), Positives = 32/63 (50%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C++ Sbjct: 315 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLE 374 Query: 72 NHG 64 +G Sbjct: 375 RNG 377 >SB_1045| Best HMM Match : Hormone_3 (HMM E-Value=3.9) Length = 153 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C++ Sbjct: 91 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLE 150 Query: 72 NH 67 + Sbjct: 151 RN 152 >SB_21757| Best HMM Match : Hormone_3 (HMM E-Value=3.9) Length = 254 Score = 35.5 bits (78), Expect = 0.039 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQ 73 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ C++ Sbjct: 91 DLNPPDFYLWGFLKDNVYQGNPQTIEKLKTAITAKINAIPKEECIKVIQNFARRVQVCLE 150 Query: 72 NH 67 + Sbjct: 151 RN 152 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 34.7 bits (76), Expect = 0.068 Identities = 26/76 (34%), Positives = 37/76 (48%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 32 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 83 Query: 267 PVFVPDEVDFTRRSQS 314 PV V D+ D R+ Q+ Sbjct: 84 PVSVVDKGDIRRKPQN 99 >SB_19248| Best HMM Match : HECT (HMM E-Value=7.2e-10) Length = 279 Score = 31.1 bits (67), Expect = 0.84 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 240 LDYKIWQHLEEKACSKPHPNLESLKTS 160 LD WQ LE+K C P +E+LK S Sbjct: 225 LDLITWQELEKKVCGDPEITVEALKKS 251 >SB_36553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 684 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 3/76 (3%) Frame = -1 Query: 457 KGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHR--AKSTQDWLRRVKST- 287 +G +A VY++ + N ++PV+HT + ++ +P A ST L R T Sbjct: 564 RGALNSAAVYKDPITMNTIDPVTHTNSASSDVTYKNHGSPYDEVTATSTYQSLDRTPRTY 623 Query: 286 SSGTKTGPPPVRFESV 239 G P +E+V Sbjct: 624 PDGRGQARGPREYEAV 639 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -2 Query: 252 DLNPLDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLK 85 DLNP D+ +W L++ +E LKT++ I + I ++ RR++ Sbjct: 700 DLNPPDFYLWGFLKDNVYQGNPQTIEELKTAITAKIRAIPKEECIKVIQNFARRVQ 755 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.5 bits (63), Expect = 2.6 Identities = 25/77 (32%), Positives = 34/77 (44%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 61 Query: 267 PVFVPDEVDFTRRSQSC 317 PV E D R + C Sbjct: 62 PVH-HIEADLANRLEDC 77 >SB_53949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1149 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 276 RRLALLQSDLNPLDYKIWQHLEEKAC 199 R L L D+ P DY+ W+ +KAC Sbjct: 524 RTLVLAYKDITPQDYQAWKSKYDKAC 549 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.5 bits (63), Expect = 2.6 Identities = 21/68 (30%), Positives = 32/68 (47%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 61 Query: 267 PVFVPDEV 290 P+F+ + Sbjct: 62 PLFITSSI 69 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = +3 Query: 63 LRDFEYRPSICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLT 242 LR++ S+ A+S L Q +G C RRL S VTP + ++ S ++C Sbjct: 70 LRNYWEGRSVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQV 124 Query: 243 DSNLTGGGPVF 275 DS G P+F Sbjct: 125 DSR---GSPLF 132 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.1 bits (62), Expect = 3.4 Identities = 22/64 (34%), Positives = 31/64 (48%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 61 Query: 267 PVFV 278 PV+V Sbjct: 62 PVYV 65 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 560 SSLLGAYTLSFGGGALFYGKIF-HPKKNFRYFFR 658 S+L+G ++ G LF+GK+ HPK N Y F+ Sbjct: 1065 STLVGMMSIGSTFGRLFFGKVCDHPKVNRLYIFQ 1098 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 28.7 bits (61), Expect = 4.5 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDS 248 S+ A+S L Q +G C RRL S VTP + ++ PS ++C DS Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTPSAKLACLQVDS 58 >SB_43370| Best HMM Match : RhoGAP (HMM E-Value=1.6e-18) Length = 865 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 382 MFNNRHWVFQQDSAPAHRAKSTQDWLRRVKST 287 +F R VF + +P + AKS + L +KST Sbjct: 357 IFGKRRGVFSSEKSPFYAAKSEPELLNEIKST 388 >SB_3378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/50 (20%), Positives = 25/50 (50%) Frame = -1 Query: 457 KGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSTQDW 308 +G +A +Y++ + N ++PV+HT + ++ +P +T + Sbjct: 4 RGALKSAALYEDPITMNTIDPVTHTNSASSDVTYKNHGSPYDEVTATSTY 53 >SB_50401| Best HMM Match : Pkinase (HMM E-Value=1.7e-16) Length = 535 Score = 28.3 bits (60), Expect = 5.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 Query: 434 CVSKYSPDEPCGTCFS 387 C K+SPDE C TC S Sbjct: 237 CAVKHSPDEICATCIS 252 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS + GG Sbjct: 24 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGG 78 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/65 (32%), Positives = 31/65 (47%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 61 Query: 267 PVFVP 281 P+ +P Sbjct: 62 PMTIP 66 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS + GG Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGG 64 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 32 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 83 Query: 267 PVF 275 P+F Sbjct: 84 PIF 86 >SB_30827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/76 (19%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = -1 Query: 457 KGVKTNAVVYQNTVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKST---QDWLRRVKST 287 +G +A + ++ + N ++PV+HT + + +P+ +T Q R ++++ Sbjct: 4 RGALNSAAIDEDPITMNTIDPVTHTTSASSDVTNENHGSPSDDVTATSTYQSLDRTIRTS 63 Query: 286 SSGTKTGPPPVRFESV 239 G P +E+V Sbjct: 64 PDGRGRARGPCEYEAV 79 >SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.3 bits (60), Expect = 5.9 Identities = 25/73 (34%), Positives = 34/73 (46%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 61 Query: 267 PVFVPDEVDFTRR 305 P FVP + F R Sbjct: 62 P-FVPFDYVFCGR 73 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 27.9 bits (59), Expect = 7.8 Identities = 23/67 (34%), Positives = 32/67 (47%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 32 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 83 Query: 267 PVFVPDE 287 P F PD+ Sbjct: 84 P-FPPDD 89 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 27.9 bits (59), Expect = 7.8 Identities = 26/79 (32%), Positives = 37/79 (46%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS G Sbjct: 798 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSR---GS 849 Query: 267 PVFVPDEVDFTRRSQSCVL 323 P V F+ R+ +CVL Sbjct: 850 PNCV-----FSIRNSACVL 863 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 27.9 bits (59), Expect = 7.8 Identities = 24/75 (32%), Positives = 35/75 (46%) Frame = +3 Query: 54 QNDLRDFEYRPSICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISC 233 +N LR+ S+ A+S L Q +G C RRL S VTP + ++ S ++C Sbjct: 18 ENLLRNCWEGRSVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLAC 72 Query: 234 NLTDSNLTGGGPVFV 278 DS G P+ V Sbjct: 73 LQVDSR---GSPLIV 84 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +3 Query: 87 SICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISCNLTDSNLTGGG 266 S+ A+S L Q +G C RRL S VTP + ++ S ++C DS + G Sbjct: 10 SVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLACLQVDSRGSPQG 64 Query: 267 P 269 P Sbjct: 65 P 65 >SB_41275| Best HMM Match : Lig_chan (HMM E-Value=2.3e-11) Length = 1171 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 529 PRWTRGIRCSFFTTGCIHLIIWW--WSSLLRENFSSEKEFPIF 651 P W + C F TGC+ L+ ++ + LR+ EF F Sbjct: 118 PVWLMTMACWIFVTGCLSLVNYYSPYGHRLRDTEGDGDEFSFF 160 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 27.9 bits (59), Expect = 7.8 Identities = 23/73 (31%), Positives = 34/73 (46%) Frame = +3 Query: 54 QNDLRDFEYRPSICAASRLSQHERGPCQYRRLP*SRMS*VTPNWDEALSTPFPPSVAISC 233 +N LR+ S+ A+S L Q +G C RRL S VTP + ++ S ++C Sbjct: 110 RNTLRNCWEGRSVRASSLLRQLAKGGCAARRL-----SWVTPGFSQSRRCKTTASAKLAC 164 Query: 234 NLTDSNLTGGGPV 272 DS + PV Sbjct: 165 LQVDSRGSPFRPV 177 >SB_10167| Best HMM Match : Trypsin (HMM E-Value=0) Length = 532 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 427 DTQLHSFLHLSHKNVPLVSPNKKLQPY 507 DT++ H +H N P+++P L PY Sbjct: 443 DTRIRIKKHFAHNNPPVLTPATNLYPY 469 >SB_5376| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1705 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -1 Query: 559 TSTVFRVSNEVIFHPRSGMVGVSYWDLPEVHFCEKGVKTNAV 434 T+ + + PR ++ WD+PE+ C K + NA+ Sbjct: 484 TTPITATQTPTVLIPRGRFTALAMWDIPEMESCVK-ISMNAL 524 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,316,103 Number of Sequences: 59808 Number of extensions: 489206 Number of successful extensions: 1776 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1763 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -