BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0200 (665 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1... 26 5.6 SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 25 7.4 SPAC6G9.15c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 9.8 >SPAC1399.01c |||purine permease |Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 356 GEISRDGSVQVLATAIITTPSLTTANTMTRKSLIKCS 466 G I DG ++A+ + TTP T A SL KC+ Sbjct: 382 GGILGDGLASLIASLMTTTPLTTFAQNNGVISLTKCA 418 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 25.4 bits (53), Expect = 7.4 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 213 SAEYKLEGDVVKVKTCISSTASRSI*KGRPSSPTTPI--KPQS*QSLLSLEKY 365 SA K+ D + K S + R + K PSSP+TPI P+ + +LSL++Y Sbjct: 518 SALAKIGHDALNRKNHASLPSRRIVYKP-PSSPSTPISMNPRP-KGILSLQQY 568 >SPAC6G9.15c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 25.0 bits (52), Expect = 9.8 Identities = 15/69 (21%), Positives = 31/69 (44%) Frame = +2 Query: 254 DVHIIDGVKKYIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQVLATAIITTPSLTTAN 433 D+H +D T K + + A+KLT + +G V V + ++ + + Sbjct: 100 DLHPLDNDSTRTSKTLKNSSEVLTASKLTDEGNSKPLLEEGEVAVSSPILLDSKDVIMGV 159 Query: 434 TMTRKSLIK 460 T + K+L++ Sbjct: 160 TKSSKNLVE 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,282,961 Number of Sequences: 5004 Number of extensions: 42765 Number of successful extensions: 98 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -