BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0194 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12852| Best HMM Match : Mic1 (HMM E-Value=0.32) 28 7.8 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 28 7.8 >SB_12852| Best HMM Match : Mic1 (HMM E-Value=0.32) Length = 1077 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -1 Query: 143 IQTAHFICDPFMILKFIFQC*TQQLIFRPYGFL 45 I AHF D F IL F+FQ T +++F G L Sbjct: 549 ILAAHFSTDRFTILAFVFQV-TYEIVFCKGGSL 580 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 121 QIKCAVCITVYCKLPRSCLSDV*AANTNEIDAVNVPAIDKESIITRRC 264 QI C+ CIT + + +C S ++ID + P ++ S++ +C Sbjct: 349 QIFCSGCITAWLRNAGACSSCRSVLEVSDIDPLKGPLLNIYSLVKIKC 396 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,078,261 Number of Sequences: 59808 Number of extensions: 318508 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -