BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0193 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY278446-1|AAP37003.1| 151|Anopheles gambiae microsomal glutath... 25 2.8 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.4 >AY278446-1|AAP37003.1| 151|Anopheles gambiae microsomal glutathione transferase GSTMIC1protein. Length = 151 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = -2 Query: 351 YFKMHKKWFISVFFFRSFQLCSLIYSLIYCYVI 253 Y + + FI++ FR+ + ++++L+Y V+ Sbjct: 90 YMLTNPEPFIAINLFRAVAIARIVHTLVYAVVV 122 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 124 DCKHT*CNICVCYNNN 171 DC+ T N C CY++N Sbjct: 789 DCEMTCPNNCACYHDN 804 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,944 Number of Sequences: 2352 Number of extensions: 9297 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -