BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0191 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40049| Best HMM Match : LRR_1 (HMM E-Value=0.082) 29 4.5 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 28 7.8 >SB_40049| Best HMM Match : LRR_1 (HMM E-Value=0.082) Length = 380 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/30 (33%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 92 DKKMQSMSPLFTTA-IILGYIDEISLDYVN 178 D +QS++P F +++ Y+DE++ D++N Sbjct: 182 DAGLQSLAPCFQLKKLVISYLDEVTHDFIN 211 >SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) Length = 1266 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 399 SLRTDNMTFSMPMPFNKIL*RIKSYSRYRTLCSSI 503 S R + + P+ FN +IK + RYR +CSS+ Sbjct: 371 SSRIETESRRAPLNFNSDEFKIKRHLRYRNICSSL 405 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,140,963 Number of Sequences: 59808 Number of extensions: 321553 Number of successful extensions: 540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -