BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0191 (663 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U39742-5|AAK39199.1| 767|Caenorhabditis elegans Hypothetical pr... 29 3.9 AF067217-2|AAF99977.1| 1887|Caenorhabditis elegans Heavy chain, ... 28 6.8 >U39742-5|AAK39199.1| 767|Caenorhabditis elegans Hypothetical protein C25F6.4 protein. Length = 767 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 377 RRPSHIGEVWKSVPLSVLNNSSIILQDGASIGTRYYDM 264 R PSH ++ S P S++NN D ++ T Y+M Sbjct: 659 RGPSHHAQLRYSAPESIVNNEFTHKSDAWAVATTVYEM 696 >AF067217-2|AAF99977.1| 1887|Caenorhabditis elegans Heavy chain, unconventional myosinprotein 7 protein. Length = 1887 Score = 27.9 bits (59), Expect = 6.8 Identities = 22/59 (37%), Positives = 25/59 (42%) Frame = +1 Query: 187 SLTTLVIKYIKFPNSAYFNQLYNAQFIS*YLVPMLAPSWRIIELLFNTESGTLFQTSPM 363 S L I Y +YFNQ YL + SW IE NTE LFQ SP+ Sbjct: 555 SFEQLCINYANEKLQSYFNQHIFQFEQEEYLKEGI--SWTNIEYTDNTECVQLFQVSPI 611 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,045,273 Number of Sequences: 27780 Number of extensions: 249901 Number of successful extensions: 423 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -