BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0191 (663 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.1 DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. 24 1.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.5 DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. 22 6.0 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +1 Query: 214 IKFPNSA-YFNQLYNAQFI 267 +KF N A Y NQ+Y QF+ Sbjct: 75 LKFSNIAPYLNQIYGGQFV 93 >DQ435338-1|ABD92653.1| 135|Apis mellifera OBP21 protein. Length = 135 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 285 RHKVL*YELSIVQLIEVC*VRKFNIFND 202 R+ ++ E VQL C ++KFN ++D Sbjct: 48 RNGIIDVENEKVQLFSECLIKKFNAYDD 75 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +2 Query: 59 YKITKSILFKADKKMQSMSPLFTTAIILGYIDEI 160 Y ++ +++ + D K+ + P++ L + DE+ Sbjct: 140 YALSVAVIHRPDTKLMKLPPMYEVMPHLYFNDEV 173 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +2 Query: 59 YKITKSILFKADKKMQSMSPLFTTAIILGYIDEI 160 Y ++ +++ + D K+ + P++ L + DE+ Sbjct: 140 YALSVAVIHRPDTKLMKLPPMYEVMPHLYFNDEV 173 >DQ435335-1|ABD92650.1| 135|Apis mellifera OBP18 protein. Length = 135 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 252 VQLIEVC*VRKFNIFND 202 VQL C ++KFN ++D Sbjct: 59 VQLFSECLIKKFNGYDD 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,401 Number of Sequences: 438 Number of extensions: 3149 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -