BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0185 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_7758| Best HMM Match : F5_F8_type_C (HMM E-Value=7.8e-26) 28 7.9 >SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 349 GSNCRCSAWGSSEVGVGDNDRSSSEAATNSSQPT 450 G N S WGS E V D R+ S +T SS+ T Sbjct: 590 GGNWDTSDWGSLESSVQDPVRTGSFGSTKSSKST 623 >SB_7758| Best HMM Match : F5_F8_type_C (HMM E-Value=7.8e-26) Length = 423 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = +2 Query: 458 RSPEATTFATQNGPVRLFPSILHIALIINSQFSKSIKNRDLYLVLKILG 604 R + ++ NG +++FP ++ ++FS +IK R + +V++ G Sbjct: 306 RGDQWQSYQDVNGVIKIFPGNSGQTTVVKNEFSPAIKARYVRIVVQAWG 354 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,894,526 Number of Sequences: 59808 Number of extensions: 356598 Number of successful extensions: 1268 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -