BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0185 (665 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006627-3|AAK85461.1| 504|Caenorhabditis elegans Hypothetical ... 27 9.1 >AC006627-3|AAK85461.1| 504|Caenorhabditis elegans Hypothetical protein E01A2.4 protein. Length = 504 Score = 27.5 bits (58), Expect = 9.1 Identities = 20/64 (31%), Positives = 26/64 (40%) Frame = -3 Query: 324 RVQQSPGRWSQLPPRRTQARLKT*SATIVSLHPVTTANRLDPPRSQASSLPDHRLRDQYK 145 R SP + S+ PPRRT+ +S PV + PPR Q S R Q + Sbjct: 95 RRDDSPRKRSRSPPRRTRRSPSPPRRRRISRSPVRRSR--SPPRRQVSRSRSPPPRRQQR 152 Query: 144 RHEP 133 P Sbjct: 153 SRSP 156 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,775,580 Number of Sequences: 27780 Number of extensions: 269324 Number of successful extensions: 749 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -