BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0183 (661 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.6 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 4.5 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 22 4.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.9 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 7.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 393 LRVAPEEHPVLLTEAPLNPKANREKM 470 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 222 KAPPSGRDGRYGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD 356 K P G G G+K E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 22.2 bits (45), Expect = 4.5 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +3 Query: 222 KAPPSGRDGRYGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD 356 K P G G G+K E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 279 LLHKSPSVHTDHHALMAGPSHDRGEHGARSIISCETGLA 163 +L K P V T + + D GEH ++ E GLA Sbjct: 113 ILEKKPDVTT----VELVDATDPGEHNGDTVTDVEAGLA 147 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 157 GMCKAGFAGD 186 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,935 Number of Sequences: 438 Number of extensions: 4175 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -