BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0182 (666 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 29 0.030 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 29 0.030 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 29 0.030 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 29 0.030 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 29 0.040 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 29 0.040 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 29 0.040 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 29 0.040 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 29 0.040 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 29 0.053 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 27 0.21 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 27 0.21 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 25 0.49 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 24 1.1 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 24 1.1 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 24 1.1 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 24 1.1 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 24 1.1 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 24 1.1 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.1 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 24 1.5 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 24 1.5 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 24 1.5 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 24 1.5 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 24 1.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 1.5 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 24 1.5 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 24 1.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.5 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 23 2.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 23 3.5 DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 3.5 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 22 4.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 4.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 4.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 6.0 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 83 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 121 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 316 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 354 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 29.5 bits (63), Expect = 0.030 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 148 NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 +N +S + Y +N++NN YN N Y N+N+ IP+ Sbjct: 316 SNNNSLSNNYNYNNNYNN--YNKHNYNKLYYNINYIEQIPI 354 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.1 bits (62), Expect = 0.040 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNT----SYLNLNFSISIPVTRFICNHIGEF 303 +SS + YK SN +NNY N+ +N Y N+N+ IP+ + + G F Sbjct: 82 ISSLSNNYKYSN-YNNYNNNNYNNNNYKKLQYYNINYIEQIPIPVPVPIYCGNF 134 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.1 bits (62), Expect = 0.040 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNT----SYLNLNFSISIPVTRFICNHIGEF 303 +SS + YK SN +NNY N+ +N Y N+N+ IP+ + + G F Sbjct: 82 ISSLSNNYKYSN-YNNYNNNNYNNNNYKKLQYYNINYIEQIPIPVPVPIYCGNF 134 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.1 bits (62), Expect = 0.040 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNT----SYLNLNFSISIPVTRFICNHIGEF 303 +SS + YK SN +NNY N+ +N Y N+N+ IP+ + + G F Sbjct: 82 ISSLSNNYKYSN-YNNYNNNNYNNNNYKKLQYYNINYIEQIPIPVPVPIYCGNF 134 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 29.1 bits (62), Expect = 0.040 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNT----SYLNLNFSISIPVTRFICNHIGEF 303 +SS + YK SN +NNY N+ +N Y N+N+ IP+ + + G F Sbjct: 82 ISSLSNNYKYSN-YNNYNNNNYNNNNYKKLQYYNINYIEQIPIPVPVPIYCGNF 134 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 29.1 bits (62), Expect = 0.040 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +1 Query: 184 SNHFNNYLYNDQTDNT---SYLNLNFSISIPVTRFICNHIGEF 303 +N++NNY YN+ N Y N+N+ IPV + + G F Sbjct: 98 NNNYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 140 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 64 NNPKNSNYHNVDYVTPN 14 NN N+NY+N +Y N Sbjct: 94 NNYNNNNYNNYNYNNNN 110 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 28.7 bits (61), Expect = 0.053 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 133 KYIN*NNVSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 K I+ NN S Y +N++NNY N N Y N+N+ IP+ Sbjct: 80 KIISNNNPLSNN--YNYNNNYNNY--NKHNYNKLYYNINYIEQIPI 121 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 26.6 bits (56), Expect = 0.21 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNTS-YLNLNFSISIPVTRFICNHIGEF 303 +SS + Y SN +NNY N N Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSN-YNNYNNNYNNYNKKLYYNINYIEQIPVPVPVPVYCGNF 131 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 187 NHFNNYLYNDQTDNTSYLNLNFSISIPVTRFICNHIGEF 303 N+ NNY YN+ Y N+N+ IP+ + + G F Sbjct: 312 NYSNNY-YNNNNYKKLYYNINYIEQIPIPVPVPIYCGNF 349 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 25.4 bits (53), Expect = 0.49 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 196 NNYLYNDQTDNTSYLNLNFSISIPVTRFICNHIGEF 303 NN YN+ + Y N+N+ IPV + + G F Sbjct: 314 NNNNYNNYNNKKLYYNINYIEQIPVPVPVPIYYGNF 349 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 181 MSNHFNNYLYNDQTDNTS--YLNLNFSISIPV 270 +S+ NNY YN+ +N + N+N+ IPV Sbjct: 315 ISSLSNNYNYNNYNNNYKPLHYNINYIEQIPV 346 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N+ IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPV 114 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N+ IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPV 114 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N+ IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPV 114 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N+ IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPV 114 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N+ IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINYIEQIPV 114 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 187 NHFNNYLYNDQTDNTSYLNLNFSISIPVTRFICNHIGEF 303 ++ +NY N+ + Y N+N+ IPV + + G F Sbjct: 91 SNISNYNNNNNYNKKLYYNINYIEQIPVPVPVPIYCGNF 129 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 + +SN++N YN+ +N + Y N+N+ IPV + + G F Sbjct: 82 VSSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPVPVPVPIYCGNF 132 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 7/51 (13%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS-------YLNLNFSISIPVTRFICNHIGEF 303 I +SN++N YN+ +N + Y N+N+ IP+ + + G F Sbjct: 82 ISSLSNNYNYSNYNNYNNNNNYNNYKKLYYNINYIEQIPIPVPVPIYCGNF 132 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 187 NHFNNYLYNDQTDNTSYLNLNFSISIPVTRFICNHIGEF 303 ++ +NY N+ + Y N+N+ IPV + + G F Sbjct: 329 SNISNYNNNNNYNKKLYYNINYIEQIPVPVPVPIYCGNF 367 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 64 NNPKNSNYHNVDYVTPNXMPN 2 +N +N+ N DY+ N MPN Sbjct: 34 DNIRNTLISNGDYIEENNMPN 54 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.6 bits (46), Expect = 3.5 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPVTRFICN 288 +SS + YK SN+ N YN + +Y+ I +PV + N Sbjct: 82 ISSLSNNYKYSNYNNYNNYNKKLYYKNYIINIEQIPVPVPIYCGN 126 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLN 243 ++KM N + YL + TD+T L+ Sbjct: 281 LHKMKNIIDYYLVLENTDHTKQLS 304 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTSYLNLNFSISIPV 270 I +SN++N YN+ N+N IPV Sbjct: 82 ISSLSNNYNYSNYNNNNYKQLCYNINHIEQIPV 114 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +1 Query: 172 IYKMSNHFNNYLYNDQTDNTS----YLNLNFSISIPVTRFICNHIGEF 303 I +SN++ + + N DN Y N+N+ IPV + + G F Sbjct: 82 ISSLSNNYISNISNYNNDNNYNKKLYYNINYIEQIPVPVPVPIYCGNF 129 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 175 YKMSNHFNNYLYNDQTDNTSYLNLNFSI-SIPV 270 Y N++NN YN+ Y N +I IPV Sbjct: 327 YNNYNNYNNNNYNNYNKKLYYKNYIINIEQIPV 359 Score = 21.8 bits (44), Expect = 6.0 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 154 VSSFT*IYKMSNHFNNYLYNDQTDNTSYLNLN 249 +SS + YK SN +NNY + +N +Y N N Sbjct: 315 ISSLSNNYKYSN-YNNY---NNYNNNNYNNYN 342 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 181 MSNHFNNYLYNDQTDNTSYLNLNFSISIPVTRFICNHIGEF 303 +S+ NN ++N+ + Y N+ IPV + H G F Sbjct: 315 ISSLSNNTIHNNNYNKKLYYNIINIEQIPVPVPVPIHCGNF 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,606 Number of Sequences: 438 Number of extensions: 3073 Number of successful extensions: 67 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20099475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -