BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0174 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 5.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 6.8 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 5.2 Identities = 13/67 (19%), Positives = 27/67 (40%) Frame = +2 Query: 53 EGREKMRRPQPDSTGKLQKFLFSKDNMKAAFDLDGLYAECKEKLASFRQNKKDE*TATAQ 232 E EK + +P + + +++ + L+G+Y +R+NK+ + Sbjct: 74 ESEEKKSKEKPPYSYNALIMMAIRNSPEKRLTLNGIYEYIMRNFPYYRENKQGWQNSIRH 133 Query: 233 VLLLPNC 253 L L C Sbjct: 134 NLSLNKC 140 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 260 YGCNWAVIRPALWR 219 Y NWA+ RP + R Sbjct: 27 YFSNWAIYRPGIGR 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,219 Number of Sequences: 336 Number of extensions: 2827 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -